Antibodies

View as table Download

GABRA2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GABRA2

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

Rabbit anti-CHRNB1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNB1

Goat Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVDRYFTQKEET, from the internal region of the protein sequence according to NP_000736.2.

Rabbit polyclonal anti-GLRB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLRB.

Anti-HTR3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic

CHRNA5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA5

Rabbit anti-GLRA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GLRA1

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus.

Rabbit anti-GABRB2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GABRB2

Rabbit anti-CHRNA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA1

Rabbit anti-HTR3A Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR3A

Rabbit anti-GABRR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GABRR1

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME

Rabbit Polyclonal Anti-GABRG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRG1 Antibody: A synthesized peptide derived from human GABRG1

Goat Polyclonal Antibody against Serotonin receptor 3A / HTR3A

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-GPQDFEKSPRDR, from the internal region of the protein sequence according to NP_998786.1; NP_000860.1.

Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416)

Rabbit polyclonal anti-5-HT-3A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-3A.

Rabbit polyclonal anti-GABRA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GABRA4.

Rabbit polyclonal anti-CHRNA10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CHRNA10.

Rabbit polyclonal CHRNA3 Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CHRNA3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-52 amino acids from the N-terminal region of human CHRNA3.

Rabbit polyclonal GABRA2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2.

Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434
Modifications Phospho-specific

Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus.

Rabbit Polyclonal Anti-CHRND Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA

Rabbit Polyclonal Anti-GABRP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE

Rabbit Polyclonal 5-HT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563.

Rabbit Polyclonal Anti-HTR3B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Goat Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QPRHHCARQRLR, from the internal region of the protein sequence according to NP_000739.1.

Rabbit polyclonal anti-CHRNB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CHRNB1.

Anti-CHRNA10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 360-373 amino acids of human cholinergic receptor, nicotinic, alpha 10 (neuronal)

Rabbit Polyclonal Anti-HTR3A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV

Rabbit Polyclonal Anti-CHRNA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1. Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG

Rabbit Polyclonal Anti-CHRNA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA9 antibody: synthetic peptide directed towards the N terminal of human CHRNA9. Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE

Rabbit Polyclonal Anti-CHRNE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNE antibody: synthetic peptide directed towards the N terminal of human CHRNE. Synthetic peptide located within the following region: GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS

Rabbit Polyclonal Anti-CHRNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNG antibody: synthetic peptide directed towards the N terminal of human CHRNG. Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY

Rabbit Polyclonal Anti-GABRD Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG

Rabbit Polyclonal Anti-HTR3E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3E antibody is: synthetic peptide directed towards the C-terminal region of Human HTR3E. Synthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM

Rabbit Polyclonal Anti-CHRNB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2. Synthetic peptide located within the following region: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1. Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the middle region of human CHRNA7. Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Rabbit Polyclonal Anti-HTR3E Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3E antibody: synthetic peptide directed towards the middle region of human HTR3E. Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG

Goat Polyclonal Antibody against CHRNA4 (aa29-43)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVETRAHAEERLLKK, from the internal region of the protein sequence according to NP_000735.1.

Goat Polyclonal Antibody against CHRNB3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1.

Goat Anti-GABRA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKAKRKTSKPPQE, from the internal region of the protein sequence according to NP_000800.2.

Goat Anti-CHRNB1 / ACHRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QEQEDHDALKED, from the internal region of the protein sequence according to NP_000738.2.

Goat Anti-Serotonin Receptor 3B / HTR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNYLQTQDQTDQQE, from the internal region (near C-terminus) of the protein sequence according to NP_006019.1.