Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IL22RA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCSF Receptor (CSF3R) mouse monoclonal antibody, clone S-1268, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against thyroid peroxidase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Rabbit polyclonal anti-CSF2RA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CSF2RA. |
Rabbit polyclonal Epo-R (Ab-426) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Epo-R. |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD130/gp130 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD130/gp130 |
Rabbit Polyclonal Anti-GHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GHR antibody is: synthetic peptide directed towards the C-terminal region of Human GHR. Synthetic peptide located within the following region: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW |
Rabbit Polyclonal Anti-IL13RA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP |
Rabbit Polyclonal Anti-IL22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL22 antibody: synthetic peptide directed towards the C terminal of human IL22. Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Rabbit Polyclonal Anti-IFNK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNK antibody is: synthetic peptide directed towards the C-terminal region of Human IFNK. Synthetic peptide located within the following region: MKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYY |
Rabbit Polyclonal IL-21 Receptor Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-21 receptor antibody was raised against a synthetic peptide corresponding to amino acids 20 to 32 of human IL-21 receptor precursor. |
Rabbit Polyclonal IL-22 Receptor Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | IL-22 receptor antibody was raised against a synthetic peptide corresponding to amino acids 560 to 574 of human IL-22 receptor precursor. |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Bcl-xL antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human Bcl-xL. |
Rabbit polyclonal antibody to IL-12 Receptor beta2 (interleukin 12 receptor, beta 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 323 and 695 of IL-12 Receptor beta2 (Uniprot ID#Q99665) |
Rabbit polyclonal antibody to IL-12R beta1(CD212) (interleukin 12 receptor, beta 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 57 and 488 of IL12 Receptor beta1 (Uniprot ID#P42701) |
Goat Anti-IL12RB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVSVKNHSLDSVS, from the Internal region of the protein sequence according to NP_005526.1. |
Rabbit polyclonal IL-2Rbeta (Tyr364) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Rβ around the phosphorylation site of tyrosine 364 (Q-G-YP-F-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-IL11RA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL11RA. |
Rabbit polyclonal IL-13R/CD213a1 (Tyr405) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-13R/CD213a1 around the phosphorylation site of tyrosine 405 (D-I-YP-E-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-IFN alpha 2b antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human IFN-alpha 2b |
Rabbit polyclonal anti-IL-29 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with mature length recombinant human IL-29 protein produced in E.coli. |
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal CD130 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CD130/gp130. |
EPOR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human EPOR |
Rabbit polyclonal anti-PRLR antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PRLR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the Central region of human PRLR. |
Rabbit Polyclonal Anti-IFNE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IFNE Antibody is: synthetic peptide directed towards the middle region of Human IFNE. Synthetic peptide located within the following region: IFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGS |
Phospho-IFNAR1-S535/S539 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S535/S539 of human IFNAR1 |
| Modifications | Phospho-specific |
Phospho-IL10RA-S319/S323 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S319/S323 of human IL10RA |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-EPOR Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPOR antibody: synthetic peptide directed towards the N terminal of human EPOR. Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL |
Rabbit Polyclonal Anti-TPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS |
Rabbit Polyclonal Anti-CRLF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Canine, Feline, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Bcl-xL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Canine, Feline, Hamster, Porcin |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817] |
Rabbit Polyclonal Anti-IL13RA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the N terminal of human IL13RA2. Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL |
Rabbit Polyclonal Anti-CSF2RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF2RA antibody is: synthetic peptide directed towards the C-terminal region of Human CSF2RA. Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW |
Active filters
Reactivities
- Human
Applications
- WB
Families
- Transmembrane
Pathways
- Jak-STAT signaling pathway
Filter by
Category
Target Symbol
- CSF2RB (30)
- IFNLR1 (27)
- IL10RA (27)
- CSF2RA (25)
- IL2RB (25)
- BCL2L1 (24)
- IL3RA (24)
- IL20RA (21)
- EPOR (14)
- IL23R (13)
- IFNL1 (11)
- IL12B (11)
- EPO (9)
- IL6R (9)
- IL12RB1 (7)
- IL2RA (7)
- CRLF2 (6)
- IL11RA (6)
- IL13 (6)
- IFNGR2 (5)
- IFNL3 (4)
- IL22RA1 (4)
- IL6ST (4)
- TPO (4)
- GHR (3)
- IFNAR1 (3)
- IFNB1 (3)
- IL13RA1 (3)
- IL22 (3)
- IL7R (3)
- PRLR (3)
- CSF3R (2)
- IFNAR2 (2)
- IFNGR1 (2)
- IL12RB2 (2)
- IL13RA2 (2)
- IL21R (2)
- IL5RA (2)
- OSMR (2)
- IFNE (1)
- IFNK (1)
- IFNL2 (1)
- IL20RB (1)
- IL2RG (1)
- IL9R (1)
- LEPR (1)