Antibodies

View as table Download

Rabbit Polyclonal Antibody against GLUT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal Anti-PAK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAK2

Rabbit Polyclonal PAK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2.

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1

Rabbit anti-PGF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PGF

Rabbit anti-PDGFB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFB

Rabbit Polyclonal Anti-RAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAF1

Rabbit polyclonal HIF1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A.

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221
Modifications Phospho-specific

Rabbit Polyclonal HIF1A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HIF1A

Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.

EGLN1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human EGLN1

Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli.

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit Polyclonal PAK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PAK1

Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607
Modifications Phospho-specific

Rabbit anti-MEK1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human MEK1

Rabbit Polyclonal anti-Elongin C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant full-length

Rabbit anti-CUL2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL2

Rabbit Polyclonal Anti-EGLN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN

Rabbit Polyclonal Anti-RAC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Rabbit Polyclonal Anti-P300/CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit polyclonal SOS2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2.

Rabbit anti-FH Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FH

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences.

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73
Modifications Phospho-specific

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-CDC42 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC42

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit Polyclonal Fumarase Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(Y387)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to Fumarate hydratase (fumarate hydratase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 365 of Fumarate hydratase (Uniprot ID#P07954)

Rabbit polyclonal Raf1 (Ab-621) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P).

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).