Antibodies

View as table Download

Rabbit polyclonal anti-ABCC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC3.

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Mouse Monoclonal ABCG2/CD338 Antibody (3G8)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Rabbit Polyclonal Anti-CFTR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR.

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)

TAP2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TAP2

Goat Polyclonal Antibody against ABCC8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2.

Rabbit Monoclonal antibody against PMP70

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ABCG2(CD338) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338).

Mouse Monoclonal MRP1 Antibody (IU5C1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse anti-ABCA1 monoclonal antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-CFTR

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part.

Mouse Monoclonal ABCA1 Antibody (HJ1) - Astrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-Abca7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV

Rabbit anti-ABCD3 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCD3.

Rabbit Polyclonal Anti-ABCG5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Goat Polyclonal Antibody against ABCB5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QTQHRNTSKKAQ, from the internal region of the protein sequence according to NP_848654.3.

Rabbit Polyclonal ABCA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information.

ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

ABCG1 rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 366~395 from the Center region of Human ABCG1

ABCD1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of human ABCD1.

Goat Polyclonal Antibody against ABCC5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1.

Goat Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2.

Rabbit Polyclonal Anti-ABCA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA12 Antibody: synthetic peptide directed towards the middle region of human ABCA12. Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

Rabbit Polyclonal Anti-ABCB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB6 antibody: synthetic peptide directed towards the middle region of human ABCB6. Synthetic peptide located within the following region: VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI

P Glycoprotein (ABCB1) mouse monoclonal antibody, clone PG-13, Purified

Applications IF, IHC, WB
Reactivities Human

ABCB5 (N-term) rabbit polyclonal antibody, Ig Fraction

Applications FC, IHC, WB
Reactivities Human
Immunogen ABCB5 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human ABCB5.

MRP3 (ABCC3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 906-933 amino acids from the Central region of human ABCC3.

Rabbit polyclonal anti-ABCB10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB10.

Rabbit polyclonal anti-ABCD4 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCD4.

Rabbit polyclonal anti-ABCD1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCD1.

Rabbit polyclonal anti-ABCB7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB7.

Rabbit polyclonal anti-ABCA8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCA8.

Rabbit polyclonal anti-ABCA6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6.

Rabbit polyclonal anti-ABCB1 antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein.

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Rabbit Polyclonal Anti-Abcc2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Rabbit Polyclonal ABCG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844]

Mouse Monoclonal ABCG5 Antibody (1B5E10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ABCG2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MRP4 (ABCC4) (70-82) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Peptide with sequence from the N Terminus (near) of the protein sequence according to NP_005836.2, NP_001098985.1.

ABCB5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ABCC10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 767-793 amino acids from the Central region of human ABCC10

ABCD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 552-582 amino acids from the C-terminal region of human ABCD2.

Goat Anti-ABCD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDDIDNPDQRISQD, from the internal region of the protein sequence according to NP_005041.1.