Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Polyclonal Antibody against PYGM (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM. |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
USD 345.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
Rabbit Polyclonal IRS-1 (Ser307) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IRS-1 around the phosphorylation site of Serine 307 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
USD 524.00
In Stock
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit Polyclonal Antibody against FRAP1 (S2481)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1). |
Rabbit monoclonal antibody against Phospho IRS-1 (pY896)(EP260Y) (Phospho-Specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against Phospho Tuberin (pS939)(EP1062Y) (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ser307) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 307 (T-E-SP-I-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Conjugates
- Unconjugated
Pathways
- Insulin signaling pathway
Availabilities
- In Stock
Filter by
Target Symbol
- MAP2K1 (86)
- BRAF (41)
- AKT1 (34)
- MTOR (30)
- FOXO1 (27)
- PIK3CG (26)
- KRAS (23)
- HRAS (22)
- IRS1 (20)
- MAPK1 (20)
- PIK3R5 (19)
- SOCS3 (16)
- AKT2 (15)
- PIK3CD (15)
- RPS6KB1 (15)
- RAPGEF1 (13)
- EIF4EBP1 (12)
- MAP2K2 (12)
- MAPK8 (12)
- MAPK9 (11)
- PTPN1 (11)
- PYGM (11)
- TSC1 (11)
- PRKAR2A (10)
- SHC1 (10)
- ARAF (9)
- MAPK3 (9)
- RAF1 (9)
- BAD (8)
- PIK3CA (8)
- PKLR (8)
- PRKAB1 (8)
- EIF4E2 (7)
- PHKG2 (7)
- PRKAR1B (7)
- CBLC (6)
- EIF4E (6)
- ELK1 (6)
- IKBKB (6)
- INSR (6)
- AKT3 (5)
- LIPE (5)
- MAPK10 (5)
- NRAS (5)
- PRKAA1 (5)
- ACACA (4)
- CBL (4)
- GCK (4)
- HK2 (4)
- PRKAR1A (4)
- PRKCZ (4)
- RHEB (4)
- RPS6KB2 (4)
- TSC2 (4)
- CRK (3)
- GYS1 (3)
- IRS2 (3)
- MKNK1 (3)
- PCK1 (3)
- PDPK1 (3)
- PPP1CB (3)
- PRKACG (3)
- RPS6 (3)
- SOCS1 (3)
- SOCS2 (3)
- CRKL (2)
- FASN (2)
- GRB2 (2)
- HK1 (2)
- INS (2)
- PHKB (2)
- PHKG1 (2)
- PIK3R3 (2)
- PPARGC1A (2)
- PPP1CA (2)
- PPP1CC (2)
- PRKAA2 (2)
- PRKAB2 (2)
- PRKACA (2)
- PRKAG1 (2)
- PRKX (2)
- PYGB (2)
- RPTOR (2)
- SH2B2 (2)
- SOCS4 (2)
- CALM1 (1)
- FBP1 (1)
- FBP2 (1)
- GSK3B (1)
- GYS2 (1)
- HK3 (1)
- INPP5K (1)
- MKNK2 (1)
- PCK2 (1)
- PDE3B (1)
- PHKA1 (1)
- PHKA2 (1)
- PIK3CB (1)
- PIK3R1 (1)
- PIK3R2 (1)