Germany
Japan
United Kingdom
China
USD 420.00
In Stock
Antibodies
Download
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against PHPT1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1. |
Rabbit polyclonal anti-OAT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Goat Anti-IDS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit Polyclonal Anti-GPT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Druggable Genome
Pathways
- Metabolic pathways
Availabilities
- In Stock
Filter by
Target Symbol
- NME1 (78)
- OTC (50)
- LIPG (49)
- PIK3C2A (44)
- TYMS (34)
- IDO1 (28)
- TYMP (27)
- ABAT (26)
- AMACR (26)
- RRM1 (24)
- TH (24)
- UPRT (22)
- ASS1 (21)
- CYP1A2 (21)
- PNMT (20)
- CMPK1 (19)
- GCH1 (19)
- LTA4H (19)
- ALOX5 (18)
- GBA (17)
- DGKA (15)
- PFKP (14)
- PPAT (14)
- ARG1 (13)
- HPRT1 (13)
- AKR1A1 (12)
- ATP5F1B (12)
- GLB1 (12)
- HMBS (12)
- MGLL (12)
- NME4 (12)
- PAFAH1B3 (12)
- PAPSS2 (12)
- SDHB (12)
- UCK1 (12)
- ACAT2 (11)
- LDHA (11)
- NFKB1 (11)
- SPR (11)
- ADH1B (10)
- ADH5 (10)
- AK1 (10)
- AK5 (10)
- HSD17B4 (10)
- NOS2 (10)
- PAICS (10)
- PGAM2 (10)
- PON1 (10)
- SORD (10)
- UQCRC1 (10)
- AK4 (9)
- ALDH3A2 (9)
- ANPEP (9)
- CYP17A1 (9)
- CYP2J2 (9)
- DLD (9)
- DTYMK (9)
- KHK (9)
- PIKFYVE (9)
- TALDO1 (9)
- TBXAS1 (9)
- ALDOB (8)
- ALOX15 (8)
- ATP6V1B1 (8)
- CAT (8)
- CPS1 (8)
- CYP2A6 (8)
- CYP2E1 (8)
- DHRS4L2 (8)
- GAD1 (8)
- GBE1 (8)
- GRHPR (8)
- IDS (8)
- NOS3 (8)
- OXSM (8)
- PKLR (8)
- ALDH1A3 (7)
- ALOX12 (7)
- CD38 (7)
- GPI (7)
- PRDX6 (7)
- ACADM (6)
- ALAS2 (6)
- ALDH3B1 (6)
- ARSB (6)
- BDH2 (6)
- HSD17B10 (6)
- MTHFR (6)
- PHGDH (6)
- PLA2G3 (6)
- PPT1 (6)
- ADH7 (5)
- AKR1B1 (5)
- ALPI (5)
- CAD (5)
- CYP2B6 (5)
- DHFR (5)
- GSS (5)
- HSD17B8 (5)
- MTMR2 (5)
Reactivities
- Human (1712)
- Mouse (1228)
- Rat (1184)
- Monkey (116)
- Dog (114)
- Bovine (12)
- Pig (8)
- Rabbit (6)
- Gorilla (5)
- X. tropicalis (5)
- Xenopus (5)
- Gibbon (4)
- Chicken (3)
- Chimpanzee (3)
- Horse (3)
- Zebrafish (3)
- Cow (2)
- Guinea Pig (2)
- Hamster (2)
- Orang-Utan (2)
- Bat (1)
- Canine (1)
- Feline (1)
- Rhesus Monkey (1)
- Sheep (1)