Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TDO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit polyclonal anti-OAT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Goat Anti-IDS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Pathways
- Metabolic pathways
Availabilities
- In Stock
Filter by
Target Symbol
- NFKB1 (9)
- NOS3 (8)
- GAPDH (7)
- TH (7)
- AKR1B1 (5)
- PLCG1 (5)
- ACACA (4)
- AK1 (4)
- ALDH3B1 (4)
- ALDOB (4)
- AMD1 (4)
- CYP19A1 (4)
- ENO2 (4)
- GPT (4)
- NOS2 (4)
- AASDHPPT (3)
- AKR1A1 (3)
- AKR1B10 (3)
- ALDH1A2 (3)
- ALDH4A1 (3)
- ALDH9A1 (3)
- ALDOA (3)
- ALOX5 (3)
- AOX1 (3)
- ASS1 (3)
- COX4I1 (3)
- CYP11A1 (3)
- CYP2E1 (3)
- DNMT1 (3)
- GAD1 (3)
- GK (3)
- NDUFA9 (3)
- PC (3)
- PCK1 (3)
- PKM (3)
- PLA2G4A (3)
- PTGS1 (3)
- TPH2 (3)
- TYR (3)
- ABO (2)
- ACAD8 (2)
- ACLY (2)
- ACMSD (2)
- ACO1 (2)
- ACO2 (2)
- ACOX1 (2)
- ACOX2 (2)
- ACOX3 (2)
- ACSM5 (2)
- ACY1 (2)
- ADH1B (2)
- ADH4 (2)
- ADO (2)
- AGPS (2)
- AKR1D1 (2)
- ALAS1 (2)
- ALAS2 (2)
- ALDH1A1 (2)
- ALDH1B1 (2)
- ALDH3A1 (2)
- ALDH3A2 (2)
- ALDH5A1 (2)
- ALDH6A1 (2)
- ALG12 (2)
- ALG2 (2)
- ALG9 (2)
- ALPL (2)
- ALPP (2)
- AMPD1 (2)
- ANPEP (2)
- APIP (2)
- ARG1 (2)
- ATP5PF (2)
- ATP6V1C2 (2)
- CAD (2)
- CAT (2)
- CBR1 (2)
- CBS (2)
- CKM (2)
- COX5B (2)
- COX6B1 (2)
- CSGALNACT2 (2)
- CYP11B1 (2)
- CYP1A2 (2)
- CYP27A1 (2)
- CYP2B6 (2)
- CYP3A4 (2)
- CYP4A11 (2)
- DGAT1 (2)
- DGKB (2)
- DHFR (2)
- DNMT3A (2)
- EHHADH (2)
- ENO1 (2)
- ENPP3 (2)
- ENPP7 (2)
- FASN (2)
- FTCD (2)
- GAD2 (2)
- GALK1 (2)
Reactivities
- Human (617)
- Mouse (473)
- Rat (415)
- Dog (18)
- Bovine (16)
- Monkey (14)
- Pig (8)
- X. tropicalis (6)
- Xenopus (6)
- Canine (5)
- Chicken (5)
- Rabbit (5)
- Zebrafish (5)
- Chimpanzee (4)
- Cow (4)
- Feline (2)
- Gibbon (2)
- Gorilla (2)
- Hamster (2)
- Primate (2)
- Rhesus Monkey (2)
- Bat (1)
- Equine (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Sheep (1)