Antibodies

View as table Download

Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal Anti-MKRN3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MKRN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MKRN3.

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).

Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253)

Goat Polyclonal Anti-Vimentin Antibody

Applications FC, IF, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2.

Rabbit Polyclonal Anti-CRBN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN.

Rabbit Polyclonal Beta-actin Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen b-actin antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human b-actin.

Anti-RHOA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A

Rabbit polyclonal MMP-2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-2.

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLDN23

Rabbit anti-NCF2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NCF2

Phospho-PTK2B-Y402 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y402 of human PTK2B
Modifications Phospho-specific

Rabbit Polyclonal Anti-ANGPTL3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ANGPTL3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ANGPTL3.

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y).
Modifications Phospho-specific

Rabbit anti-ACTN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTN1

MSN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MSN

Phospho-PXN-Y118 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y118 of human PXN
Modifications Phospho-specific

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA

Goat Polyclonal Antibody against ITGAM

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNDGEDSYRTQ, from the internal region of the protein sequence according to NP_000623.2.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH
Modifications Phospho-specific

Anti-PTK2B Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.400~404 (D-I-Y-A-E) derived from Human Pyk2.

Anti-RAC2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)

PLCG2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCG2

Rabbit Polyclonal Anti-Claudin 2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 2 Antibody: A synthesized peptide derived from human Claudin 2

USD 300.00

In Stock

Goat Polyclonal Anti-CD31 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli.

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-MMP9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MMP9

Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).
Modifications Phospho-specific

Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607
Modifications Phospho-specific

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1

Rabbit Polyclonal Vinculin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin.

Rabbit anti-ITGB2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGB2