Germany
Japan
United Kingdom
China
Antibodies
IL7 rat monoclonal antibody, clone BVD10-40F6, Purified
| Applications | ELISA |
| Reactivities | Human |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10264, Purified
| Applications | ELISA |
| Reactivities | Human |
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
USD 399.00
In Stock
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight633 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 633 |
USD 379.00
In Stock
USD 428.00
In Stock
Active filters
Category
-
- Antibodies
-
Families
- Druggable Genome
Filter by
Target Symbol
- ALK (279)
- VSNL1 (273)
- KLK8 (256)
- TP53 (255)
- ERBB2 (239)
- MAP2K1 (237)
- CD4 (232)
- PDCD1 (220)
- CD5 (208)
- EGFR (207)
- CDKN2A (198)
- JUN (183)
- NME1 (177)
- PGR (172)
- ABCB1 (168)
- CTNNB1 (162)
- MKI67 (160)
- MAP2K3 (158)
- ERCC1 (157)
- GLI1 (151)
- UCHL1 (151)
- PECAM1 (148)
- IL6 (144)
- NBN (142)
- TG (137)
- LIPG (133)
- CD274 (131)
- CD68 (131)
- CTAG1B (131)
- AKT1 (127)
- OTC (127)
- HAVCR2 (126)
- CD40 (125)
- CD99 (121)
- MDM2 (121)
- PCNA (121)
- PTPRC (120)
- AFP (116)
- NKX3-1 (115)
- CFI (112)
- PIK3C2A (112)
- ADIPOQ (111)
- APP (111)
- IL1RL1 (109)
- IL17A (108)
- TOP2A (106)
- VWF (106)
- CD44 (105)
- CD80 (103)
- BRAF (100)
- BCL2 (99)
- CTLA4 (99)
- MAPK13 (99)
- CD47 (98)
- CD63 (98)
- F13A1 (98)
- L1CAM (96)
- SENP2 (95)
- MAPT (94)
- KIT (93)
- MPO (92)
- MS4A1 (90)
- PNMT (89)
- TNFRSF8 (89)
- TYMS (89)
- MLH1 (88)
- NKX2-1 (88)
- CD19 (86)
- CD33 (84)
- CHGA (84)
- LGR5 (84)
- MDM4 (81)
- NEFL (78)
- CD27 (76)
- STAT5A (76)
- LOX (75)
- ALDH1L1 (74)
- BCL10 (74)
- FSHB (74)
- MAPK1 (74)
- NCAM1 (74)
- PROCR (74)
- ERBB3 (73)
- NPPB (73)
- UBA52 (73)
- ESR1 (72)
- MTOR (72)
- BTK (71)
- CD163 (71)
- SQSTM1 (71)
- STAT4 (71)
- CNOT4 (70)
- MMP3 (70)
- BSG (69)
- CDH1 (69)
- PTPRE (69)
- SNAI2 (69)
- TNFRSF9 (69)
- CD8A (68)
- LTA4H (68)
Reactivities
- Human (58819)
- Mouse (33387)
- Rat (30144)
- Dog (3328)
- Monkey (3247)
- Bovine (654)
- Pig (509)
- Cow (440)
- Chicken (246)
- Rabbit (240)
- Hamster (175)
- Canine (162)
- Xenopus (149)
- Gorilla (132)
- Primate (130)
- Horse (123)
- Rhesus Monkey (105)
- Gibbon (103)
- Bat (92)
- Zebrafish (91)
- Chimpanzee (88)
- Porcine (67)
- X. tropicalis (56)
- Guinea Pig (50)
- Sheep (45)
- Drosophila (30)
- Feline (28)
- Orang-Utan (28)
- Macaque (23)
- Mammalian (19)
- Equine (13)
- Canis (11)
- Frog (11)
- Goat (8)
- Fish (7)
- Opossum (7)
- Yeast (7)
- C. elegans (6)
- Gerbil (5)
- Murine (5)
- Avian (4)
- Quail (4)
- Baboon (3)
- Insect (3)
- Saccharomyces cerevisiae (3)
- All Species (2)
- Dictyostelium (2)
- Escherichia coli (2)
- Ferret (2)
- Fungus (2)
- Invertebrate (2)
- Plant (2)
- Turkey (2)
- Algal (1)
- Amphibian (1)
- Chlamydomonas (1)
- Coral (1)
- Eukaryote (1)
- Fungi (1)
- Helicobacter pylori (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Salmonella Typhimurium (1)
- Spinach (1)
- Squirrel (1)
- Tobacco hornworm (1)
- Trichinella spiralis (1)
- White Fly (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (7634)
- Metabolic pathways (5937)
- MAPK signaling pathway (4381)
- Cytokine-cytokine receptor interaction (3909)
- Focal adhesion (3887)
- Prostate cancer (3608)
- T cell receptor signaling pathway (3250)
- Neurotrophin signaling pathway (3046)
- Colorectal cancer (2984)
- Toll-like receptor signaling pathway (2903)
- ErbB signaling pathway (2801)
- Pancreatic cancer (2785)
- Regulation of actin cytoskeleton (2651)
- Melanoma (2593)
- Chronic myeloid leukemia (2582)
- Glioma (2499)
- Cell adhesion molecules (CAMs) (2493)
- Hematopoietic cell lineage (2456)
- Endometrial cancer (2435)
- Jak-STAT signaling pathway (2398)
- Non-small cell lung cancer (2383)
- Bladder cancer (2382)
- Chemokine signaling pathway (2380)
- Cell cycle (2334)
- Progesterone-mediated oocyte maturation (2301)
- Insulin signaling pathway (2228)
- B cell receptor signaling pathway (2194)
- Apoptosis (2090)
- GnRH signaling pathway (1960)
- Acute myeloid leukemia (1949)
- Fc epsilon RI signaling pathway (1917)
- Small cell lung cancer (1894)
- Natural killer cell mediated cytotoxicity (1879)
- Renal cell carcinoma (1854)
- Wnt signaling pathway (1851)
- Endocytosis (1774)
- Neuroactive ligand-receptor interaction (1703)
- Leukocyte transendothelial migration (1699)
- Calcium signaling pathway (1641)
- p53 signaling pathway (1634)
- VEGF signaling pathway (1631)
- Gap junction (1622)
- Adherens junction (1587)
- Fc gamma R-mediated phagocytosis (1509)
- Oocyte meiosis (1465)
- Amyotrophic lateral sclerosis (ALS) (1429)
- Adipocytokine signaling pathway (1417)
- Melanogenesis (1393)
- Thyroid cancer (1356)
- Alzheimer's disease (1331)
- Epithelial cell signaling in Helicobacter pylori infection (1330)
- Axon guidance (1229)
- NOD-like receptor signaling pathway (1206)
- Purine metabolism (1135)
- Complement and coagulation cascades (1111)
- Long-term depression (1100)
- TGF-beta signaling pathway (1081)
- Type II diabetes mellitus (1064)
- Vascular smooth muscle contraction (1058)
- Primary immunodeficiency (1052)
- Long-term potentiation (1048)
- mTOR signaling pathway (1045)
- Tight junction (1040)
- Huntington's disease (1007)
- Ubiquitin mediated proteolysis (996)
- Basal cell carcinoma (966)
- Hypertrophic cardiomyopathy (HCM) (916)
- RIG-I-like receptor signaling pathway (908)
- Prion diseases (858)
- ECM-receptor interaction (842)
- Pathogenic Escherichia coli infection (842)
- Pyrimidine metabolism (802)
- Autoimmune thyroid disease (801)
- Dilated cardiomyopathy (776)
- Viral myocarditis (761)
- Lysosome (745)
- Antigen processing and presentation (724)
- Glycolysis / Gluconeogenesis (713)
- Dorso-ventral axis formation (711)
- Systemic lupus erythematosus (699)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (676)
- Allograft rejection (667)
- Cytosolic DNA-sensing pathway (662)
- Type I diabetes mellitus (661)
- Hedgehog signaling pathway (654)
- Nucleotide excision repair (650)
- Graft-versus-host disease (632)
- Parkinson's disease (632)
- Phosphatidylinositol signaling system (594)
- PPAR signaling pathway (579)
- Glycerolipid metabolism (518)
- Arginine and proline metabolism (514)
- Proteasome (500)
- Arachidonic acid metabolism (482)
- Drug metabolism - cytochrome P450 (454)
- Metabolism of xenobiotics by cytochrome P450 (445)
- Valine (437)
- Base excision repair (425)
- Inositol phosphate metabolism (413)
- Mismatch repair (405)
- leucine and isoleucine degradation (405)
- Pyruvate metabolism (403)
- Tyrosine metabolism (397)
- ABC transporters (377)
- Tryptophan metabolism (371)
- Retinol metabolism (361)
- Lysine degradation (357)
- DNA replication (350)
- Alanine (346)
- aspartate and glutamate metabolism (346)
- Notch signaling pathway (345)
- Butanoate metabolism (328)
- Renin-angiotensin system (328)
- Fatty acid metabolism (327)
- Homologous recombination (321)
- Fructose and mannose metabolism (314)
- Propanoate metabolism (307)
- Asthma (296)
- Drug metabolism - other enzymes (294)
- Vibrio cholerae infection (294)
- Olfactory transduction (275)
- Maturity onset diabetes of the young (261)
- Cardiac muscle contraction (260)
- Glutathione metabolism (253)
- Linoleic acid metabolism (235)
- Regulation of autophagy (218)
- One carbon pool by folate (215)
- Histidine metabolism (214)
- beta-Alanine metabolism (205)
- Pentose phosphate pathway (200)
- Sphingolipid metabolism (197)
- SNARE interactions in vesicular transport (193)
- Galactose metabolism (184)
- Oxidative phosphorylation (182)
- Starch and sucrose metabolism (182)
- Citrate cycle (TCA cycle) (180)
- Glycerophospholipid metabolism (174)
- Amino sugar and nucleotide sugar metabolism (158)
- RNA degradation (156)
- Folate biosynthesis (154)
- Circadian rhythm - mammal (146)
- Taste transduction (146)
- Glycine (143)
- Ribosome (143)
- serine and threonine metabolism (143)
- Nitrogen metabolism (136)
- Phenylalanine metabolism (135)
- Cysteine and methionine metabolism (128)
- Spliceosome (127)
- Porphyrin and chlorophyll metabolism (125)
- Primary bile acid biosynthesis (123)
- Other glycan degradation (120)
- Non-homologous end-joining (115)
- Terpenoid backbone biosynthesis (114)
- Caffeine metabolism (112)
- Methane metabolism (109)
- Basal transcription factors (104)
- Synthesis and degradation of ketone bodies (102)
- Androgen and estrogen metabolism (101)
- Ether lipid metabolism (94)
- Glycosaminoglycan degradation (93)
- Limonene and pinene degradation (81)
- Ascorbate and aldarate metabolism (80)
- C21-Steroid hormone metabolism (76)
- Glyoxylate and dicarboxylate metabolism (72)
- Riboflavin metabolism (69)
- Nicotinate and nicotinamide metabolism (67)
- Selenoamino acid metabolism (65)
- Pantothenate and CoA biosynthesis (54)
- Sulfur metabolism (53)
- Pentose and glucuronate interconversions (50)
- leucine and isoleucine biosynthesis (46)
- Aminoacyl-tRNA biosynthesis (45)
- Taurine and hypotaurine metabolism (40)
- Biosynthesis of unsaturated fatty acids (39)
- Fatty acid biosynthesis (38)
- alpha-Linolenic acid metabolism (37)
- Glycosphingolipid biosynthesis - ganglio series (35)
- Glycosphingolipid biosynthesis - globo series (35)
- Steroid biosynthesis (32)
- Thiamine metabolism (31)
- Fatty acid elongation in mitochondria (28)
- Phenylalanine (19)
- tyrosine and tryptophan biosynthesis (19)
- Vitamin B6 metabolism (18)
- N-Glycan biosynthesis (17)
- Ubiquinone and other terpenoid-quinone biosynthesis (16)
- Protein export (12)
- Heparan sulfate biosynthesis (7)
- O-Glycan biosynthesis (6)
- D-Glutamine and D-glutamate metabolism (5)
- Glycosphingolipid biosynthesis - lacto and neolacto series (5)
- RNA polymerase (5)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (3)
- Lysine biosynthesis (3)
- Chondroitin sulfate biosynthesis (2)
- D-Arginine and D-ornithine metabolism (2)
- Keratan sulfate biosynthesis (1)