Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit monoclonal anti-POSTN antibody for SISCAPA, clone OTIR1A5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CD5L antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
USD 380.00
In Stock
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Families
- Secreted Protein
Filter by
Target Symbol
- EGFR (51)
- ERBB3 (12)
- GCG (12)
- LTF (12)
- TNFRSF11B (12)
- AFP (11)
- CXCL12 (11)
- F13A1 (11)
- GDF15 (11)
- IL2 (11)
- IL4 (11)
- LGALS3 (11)
- MUC1 (11)
- SPP1 (11)
- VEGFA (11)
- BDNF (10)
- CALR (10)
- EPOR (10)
- FN1 (10)
- GNAS (10)
- MMP1 (10)
- NPPB (10)
- NRG1 (10)
- PLAC1 (10)
- TNF (10)
- APOH (9)
- DCN (9)
- FGF4 (9)
- FGFR2 (9)
- LEP (9)
- SERPINB5 (9)
- TNFRSF1B (9)
- VEGFB (9)
- ACE2 (8)
- AGER (8)
- AGT (8)
- CCL2 (8)
- CD40 (8)
- CRP (8)
- EDA (8)
- FASLG (8)
- FGF2 (8)
- FLT1 (8)
- HSD17B13 (8)
- IGF1 (8)
- IL16 (8)
- IL17A (8)
- IL1RN (8)
- NGF (8)
- PGF (8)
- PLG (8)
- PTHLH (8)
- TGFB1 (8)
- TNFSF13 (8)
- AMPH (7)
- ANXA2 (7)
- EPHA3 (7)
- F8 (7)
- FAS (7)
- FGB (7)
- FGF1 (7)
- FST (7)
- IFNG (7)
- IGFBP1 (7)
- IL12A (7)
- IL33 (7)
- IL7 (7)
- KLK3 (7)
- SERPINA1 (7)
- SERPINC1 (7)
- SYT1 (7)
- TAC1 (7)
- TGFB2 (7)
- THPO (7)
- TIMP4 (7)
- TNC (7)
- WNT2B (7)
- ADAM9 (6)
- AGR2 (6)
- AMH (6)
- ANGPT2 (6)
- APOE (6)
- B2M (6)
- BTC (6)
- CLU (6)
- CSF1 (6)
- CXCL1 (6)
- DEFA1 (6)
- DKK3 (6)
- EIF2AK3 (6)
- F9 (6)
- FGG (6)
- FOLR1 (6)
- IFNB1 (6)
- IGFBP3 (6)
- IL23A (6)
- IL32 (6)
- IL9 (6)
- KLK7 (6)
- KNG1 (6)
Reactivities
- Human (2740)
- Mouse (1226)
- Rat (982)
- Dog (62)
- Bovine (47)
- Pig (47)
- Monkey (32)
- Cow (25)
- Rabbit (22)
- Chicken (17)
- Gorilla (16)
- Gibbon (15)
- Horse (14)
- Bat (13)
- Hamster (13)
- Canine (8)
- Chimpanzee (6)
- Macaque (5)
- Primate (5)
- Rhesus Monkey (5)
- Xenopus (4)
- Guinea Pig (3)
- Orang-Utan (3)
- Porcine (3)
- Zebrafish (3)
- Feline (2)
- Opossum (2)
- Equine (1)
- Goat (1)
- Mammalian (1)
- Pufferfish (1)
- Sheep (1)
- SimianIVE (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- Cytokine-cytokine receptor interaction (611)
- Pathways in cancer (354)
- MAPK signaling pathway (215)
- Jak-STAT signaling pathway (211)
- Focal adhesion (168)
- Complement and coagulation cascades (154)
- Regulation of actin cytoskeleton (148)
- Chemokine signaling pathway (138)
- Melanoma (124)
- Hematopoietic cell lineage (121)
- Hedgehog signaling pathway (108)
- Pancreatic cancer (108)
- TGF-beta signaling pathway (104)
- Wnt signaling pathway (102)
- Bladder cancer (99)
- Melanogenesis (96)
- Toll-like receptor signaling pathway (93)
- Basal cell carcinoma (90)
- Endocytosis (87)
- ErbB signaling pathway (85)
- Prostate cancer (85)
- GnRH signaling pathway (84)
- Allograft rejection (83)
- Calcium signaling pathway (73)
- Autoimmune thyroid disease (71)
- ECM-receptor interaction (71)
- Colorectal cancer (68)
- Type I diabetes mellitus (68)
- T cell receptor signaling pathway (67)
- Epithelial cell signaling in Helicobacter pylori infection (65)
- Glioma (65)
- Asthma (63)
- Gap junction (62)
- NOD-like receptor signaling pathway (61)
- Graft-versus-host disease (57)
- Metabolic pathways (57)
- Non-small cell lung cancer (57)
- Renal cell carcinoma (57)
- Apoptosis (56)
- Natural killer cell mediated cytotoxicity (55)
- Neuroactive ligand-receptor interaction (55)
- Systemic lupus erythematosus (53)
- Adherens junction (51)
- Dorso-ventral axis formation (51)
- Endometrial cancer (51)
- Cytosolic DNA-sensing pathway (49)
- Fc epsilon RI signaling pathway (49)
- Adipocytokine signaling pathway (46)
- Dilated cardiomyopathy (46)
- RIG-I-like receptor signaling pathway (46)
- Hypertrophic cardiomyopathy (HCM) (45)
- mTOR signaling pathway (45)
- p53 signaling pathway (42)
- Alzheimer's disease (40)
- Antigen processing and presentation (37)
- Axon guidance (36)
- PPAR signaling pathway (36)
- Prion diseases (36)
- Neurotrophin signaling pathway (32)
- Long-term depression (31)
- Renin-angiotensin system (27)
- Small cell lung cancer (26)
- Amyotrophic lateral sclerosis (ALS) (25)
- Primary immunodeficiency (24)
- Cell cycle (23)
- Cell adhesion molecules (CAMs) (22)
- Regulation of autophagy (21)
- VEGF signaling pathway (21)
- Vascular smooth muscle contraction (20)
- Chronic myeloid leukemia (17)
- Type II diabetes mellitus (17)
- Arachidonic acid metabolism (13)
- Ether lipid metabolism (13)
- Fc gamma R-mediated phagocytosis (13)
- Viral myocarditis (13)
- Glycerolipid metabolism (11)
- Leukocyte transendothelial migration (11)
- Oocyte meiosis (11)
- Progesterone-mediated oocyte maturation (11)
- Glycerophospholipid metabolism (10)
- Huntington's disease (10)
- Linoleic acid metabolism (10)
- Taste transduction (10)
- Vibrio cholerae infection (10)
- alpha-Linolenic acid metabolism (10)
- SNARE interactions in vesicular transport (9)
- Glycosaminoglycan degradation (8)
- Glycosphingolipid biosynthesis - lacto and neolacto series (7)
- Maturity onset diabetes of the young (7)
- Proteasome (7)
- Histidine metabolism (4)
- Purine metabolism (4)
- Pyrimidine metabolism (4)
- Riboflavin metabolism (4)
- Starch and sucrose metabolism (4)
- Tyrosine metabolism (4)
- Acute myeloid leukemia (3)
- Amino sugar and nucleotide sugar metabolism (3)
- Glutathione metabolism (3)
- Insulin signaling pathway (3)
- Keratan sulfate biosynthesis (3)
- Pathogenic Escherichia coli infection (3)
- Arginine and proline metabolism (2)
- Lysosome (2)
- N-Glycan biosynthesis (2)
- O-Glycan biosynthesis (2)
- Tryptophan metabolism (2)
- beta-Alanine metabolism (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Folate biosynthesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Nitrogen metabolism (1)
- Other glycan degradation (1)