Antibodies

View as table Download

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit polyclonal anti-PGC-1alpha antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS

Mouse Monoclonal SREBP1 Antibody (2A4)

Applications WB
Reactivities Human, Mouse, Rat, Golden Syrian Hamster
Conjugation Unconjugated

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF2 antibody was raised against a 15 amino acid peptide near the center of human SREBF2.

Rabbit Polyclonal Anti-MALT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1.

Rabbit anti-PPARGC1A polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human PGC-1.

Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221
Modifications Phospho-specific

Rabbit polyclonal anti-KAP0 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0.

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

Rabbit Polyclonal SREBP1 Antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956]

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

Rabbit Polyclonal ELK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

p38 (CRK) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

FOXO1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen 15 amino acid peptide near the amino terminus of human FOXO1

Rabbit Polyclonal Antibody against EIF4E2 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2.

Rabbit polyclonal Elk-1(Ab-383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Elk-1 around the phosphorylation site of Serine 383.

FOXO1 / FKHR Mouse Monoclonal (aa242-655) (7h3) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-CBL (phospho-Tyr700) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 770 (T-E-Y(p)-M-T) derived from Human c-Cbl.
Modifications Phospho-specific

Rabbit polyclonal FKHR (Phospho-Ser256) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human FKHR around the phosphorylation site of serine 256 (A-A-SP-M-D).
Modifications Phospho-specific

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-PRKAR1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAR1A antibody: synthetic peptide directed towards the C terminal of human PRKAR1A. Synthetic peptide located within the following region: MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS

Rabbit Polyclonal Anti-PRKAR1A Antibody - N-terminal region

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Prkar1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Prkar1a. Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Mouse Monoclonal FOXO1 (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

FOXO1 pSer256 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

FOXO1 pSer319 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal Cbl Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Cbl antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human cbl.

Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920)

Rabbit polyclonal anti-Elk1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Elk1.

Anti-FOXO1 (Phospho-Ser319) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 319 (T-S-S(p)-N-A) derived from Human FKHR/FOXO1A.
Modifications Phospho-specific

Anti-ELK1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.387~391 (P-R-S-P-A) derived from Human Elk1.

Rabbit Polyclonal CBL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CBL

Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674
Modifications Phospho-specific

Rabbit Polyclonal CrkII Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CrkII

Rabbit Polyclonal Elk1 (Ser389) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Elk1 around the phosphorylation site of Serine 389
Modifications Phospho-specific

Rabbit Polyclonal Elk1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Elk1

Rabbit Polyclonal Elk1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Elk1

Rabbit Polyclonal FKHR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FKHR

Rabbit Polyclonal FOXO1/3/4-pan Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FOXO1/3/4-pan

Rabbit Polyclonal FOXO1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FOXO1A

Rabbit Polyclonal FKHR (Ser256) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FKHR around the phosphorylation site of Serine 256
Modifications Phospho-specific

Rabbit Polyclonal FKHR (Ser319) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FKHR around the phosphorylation site of Serine 319
Modifications Phospho-specific

Rabbit Polyclonal FOXO1/3/4-pan (Thr24/32) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human FOXO1/3/4-pan around the phosphorylation site of Threonine 24/32
Modifications Phospho-specific

Rabbit Polyclonal IKK-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-beta

Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188
Modifications Phospho-specific