Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | PE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Purified
| Applications | FC, IHC, IP |
| Reactivities | Porcine |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, PE
| Applications | FC |
| Reactivities | Porcine |
| Conjugation | PE |
CD19 mouse monoclonal antibody, clone HD37, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
IFITM1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD225 / IFITM1 antibody was raised against a 16 amino acid synthetic peptide near the center of human IFITM1. The immunogen is located within amino acids 40 - 90 of IFITM1. |
CD79B Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD79B |
Rabbit anti-CD19 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD19 |
Rabbit anti-CD22 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD22 |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
| Modifications | Phospho-specific |
Mouse monoclonal Anti-CD21L Clone R4/23
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, FITC
| Applications | FC |
| Reactivities | Porcine |
| Conjugation | FITC |
CD22 mouse monoclonal antibody, clone B-ly8, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD72 mouse monoclonal antibody, clone 3F3, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit Polyclonal Antibody against CD19 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-421 amino acids from the C-terminal region of human CD19. |
Rabbit polyclonal anti-CD79A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit polyclonal BL-CAM (Ab-807) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BL-CAM around the phosphorylation site of tyrosine 807 (G-D-YP-E-N). |
Rabbit polyclonal CD32 (Phospho-Tyr292) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD32 around the phosphorylation site of tyrosine 292 (I-T-YP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CD19 (Ab-531) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N). |
Rabbit Polyclonal CD22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
CD19 mouse monoclonal antibody, clone 4G7, Purified
| Applications | FC, IF |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone 4G7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, FITC
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | FITC |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD21 (CR2) mouse monoclonal antibody, clone B-E5, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD21 (CR2) mouse monoclonal antibody, clone B-E5, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD21 (CR2) mouse monoclonal antibody, clone B-ly4, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD22 mouse monoclonal antibody, clone B-ly8, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD22 mouse monoclonal antibody, clone B-ly8, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
IFITM1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human IFITM1 |
TAPA1 (CD81) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
Goat Polyclonal Antibody against CD32 / FCGR2B
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
Anti-CD79B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 29-159 amino acids of human CD79b molecule, immunoglobulin-associated beta |
Mouse monoclonal Anti-FCGR2 Clone KB61
| Reactivities | Human |
| Conjugation | Unconjugated |
CD21 (CR2) mouse monoclonal antibody, clone BB6-11C9.6, Biotin
| Applications | FC |
| Reactivities | Porcine |
| Conjugation | Biotin |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Pathways
- B cell receptor signaling pathway