Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit polyclonal anti-LAMP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 403 of rat LAMP2 |
Rabbit Polyclonal Anti-SLC11A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A2 Antibody: synthetic peptide directed towards the N terminal of human SLC11A2. Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
Rabbit Polyclonal LAMP-2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | LAMP-2 antibody was raised against a 17 amino acid synthetic peptide from near the carboxy terminus of human LAMP-2. The immunogen is located within the last 50 amino acids of LAMP-2. |
Rabbit polyclonal IGF2R (Ser2409) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF2R around the phosphorylation site of serine 2409 (Q-D-SP-E-D). |
| Modifications | Phospho-specific |
Rabbit anti-ATP6AP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATP6AP1 |
USD 480.00
2 Weeks
Rabbit polyclonal anti-GUSB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal LAMP1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LAMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 125-154 amino acids from the N-terminal region of human LAMP1. |
Rabbit Polyclonal Anti-GAA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Rabbit Polyclonal Anti-LAMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
Rabbit polyclonal antibody to V-ATPase 116 kDa isoform a4 (ATPase, H+ transporting, lysosomal V0 subunit a4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 295 of V-ATPase 116 kDa isoform a4 (Uniprot ID#Q9HBG4) |
Anti-CD68 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Feline, Human, Monkey, Rat |
Rabbit Polyclonal Anti-SLC11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A1 Antibody: synthetic peptide directed towards the C terminal of human SLC11A1. Synthetic peptide located within the following region: VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT |
Rabbit Polyclonal Anti-Ctns Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP |
Rabbit Polyclonal Anti-GNPTAB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNPTAB antibody: synthetic peptide directed towards the N terminal of human GNPTAB. Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
M6PR mouse monoclonal antibody, clone AT2B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
M6PR mouse monoclonal antibody, clone AT2B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
IGF2R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
IGF2R mouse monoclonal antibody, clone MEM-238, APC
| Applications | FC, WB |
| Reactivities | Human, Primate |
| Conjugation | APC |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Pathways
- Lysosome
Filter by
Target Symbol
- CD68 (131)
- CD63 (98)
- NEU1 (41)
- LAMP1 (22)
- SMPD1 (11)
- SCARB2 (10)
- IGF2R (8)
- M6PR (8)
- SORT1 (8)
- SLC11A2 (6)
- ABCB9 (5)
- LAMP3 (5)
- ATP6AP1 (4)
- DNASE2B (4)
- GUSB (4)
- LAMP2 (4)
- ACP2 (3)
- GNS (3)
- NPC1 (3)
- SLC11A1 (3)
- ABCA2 (2)
- ATP6V0A1 (2)
- ATP6V0A2 (2)
- ATP6V0B (2)
- ATP6V0C (2)
- GAA (2)
- HGSNAT (2)
- LAPTM4B (2)
- TCIRG1 (2)
- ATP6V0A4 (1)
- CTNS (1)
- GNPTAB (1)
- HEXB (1)
- LAPTM4A (1)
- LAPTM5 (1)
- MFSD8 (1)
- NAGPA (1)
- SLC17A5 (1)