Germany
Japan
United Kingdom
China
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Antibodies
Download
PF4 mouse monoclonal antibody, clone KKO, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CXCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit Polyclonal Antibody against STAT3 (Phospho-STAT3-Y727 ) (Phospho-Specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal Anti-GNB4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNB4 antibody: synthetic peptide directed towards the middle region of human GNB4. Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Active filters
Category
- Antibodies
Pathways
- Chemokine signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- AKT1 (127)
- BRAF (100)
- MAPK1 (74)
- PIK3CG (64)
- KRAS (58)
- RELA (54)
- STAT1 (52)
- PXN (49)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- IKBKG (41)
- PTK2 (41)
- NFKB1 (36)
- JAK2 (35)
- PIK3CD (35)
- FOXO3 (34)
- RAF1 (33)
- STAT3 (33)
- SHC1 (32)
- BCAR1 (30)
- NFKBIA (30)
- CCL2 (27)
- CHUK (26)
- CXCL8 (26)
- PAK1 (26)
- PIK3CA (25)
- ARRB1 (23)
- CXCR4 (23)
- MAPK3 (23)
- WASL (21)
- GSK3B (20)
- IKBKB (20)
- AKT3 (19)
- GSK3A (19)
- PRKCD (19)
- STAT5B (18)
- CCL19 (17)
- NRAS (17)
- CCL5 (16)
- CXCL12 (16)
- GRK1 (15)
- ROCK2 (15)
- DOCK2 (14)
- GRK4 (14)
- JAK3 (14)
- PIK3R1 (14)
- NFKBIB (13)
- NCF1 (12)
- PRKCB (12)
- CCL3 (11)
- CCR5 (11)
- CCR7 (11)
- GRB2 (11)
- CCL11 (10)
- CCL27 (10)
- CX3CR1 (10)
- GNAI1 (10)
- GRK2 (10)
- STAT2 (10)
- VAV1 (10)
- CXCL10 (9)
- CXCR2 (9)
- CXCR3 (9)
- GRK5 (9)
- PTK2B (9)
- RHOA (9)
- CCL20 (8)
- CCL28 (8)
- CCL7 (8)
- CCR8 (8)
- CRK (8)
- CSK (8)
- PRKACA (8)
- PRKCZ (8)
- CCR3 (7)
- CCR4 (7)
- CRKL (7)
- CX3CL1 (7)
- LYN (7)
- PF4 (7)
- ROCK1 (7)
- CXCL1 (6)
- FGR (6)
- GRK3 (6)
- RAC1 (6)
- RAP1A (6)
- CCR1 (5)
- CDC42 (5)
- CXCL14 (5)
- CXCR1 (5)
- CXCR6 (5)
- GNG7 (5)
- HCK (5)
- PPBP (5)
- WAS (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
Reactivities
- Human (2115)
- Mouse (1652)
- Rat (1545)
- Dog (363)
- Monkey (357)
- Bovine (34)
- Chicken (21)
- Pig (15)
- Cow (12)
- Canis (8)
- Rabbit (8)
- Xenopus (8)
- Primate (7)
- Gorilla (6)
- Hamster (6)
- Canine (5)
- Drosophila (4)
- Gibbon (4)
- Rhesus Monkey (4)
- Chimpanzee (2)
- Equine (2)
- Horse (2)
- Sheep (2)
- X. tropicalis (2)
- C. elegans (1)
- Guinea Pig (1)
- Macaque (1)
- Porcine (1)
- Zebrafish (1)