Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KIR3DL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIR3DL1 antibody is: synthetic peptide directed towards the middle region of Human KIR3DL1. Synthetic peptide located within the following region: EHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVT |
Rabbit Polyclonal Anti-Granzyme B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Granzyme B Antibody: A synthesized peptide derived from human Granzyme B |
Rabbit Polyclonal Anti-Interferon gamma Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Rabbit Polyclonal Anti-FAS ligand Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified
| Applications | ELISA, FC, IP |
| Reactivities | Human |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 315, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free
| Applications | FC, IHC, WB |
| Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
IL2 mouse monoclonal antibody, clone B-G5, Azide Free
| Applications | FC, FN, WB |
| Reactivities | Human |
IL6 goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant human IL-6 |
IL6 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinant Chicken IL-6. |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Mouse Anti-Human CD95 (APO-1/Fas) Purified
| Applications | FC |
| Reactivities | Human |
Mouse Anti-Human HLA-DR Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CD28 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Mouse monoclonal HLA-G Antibody(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Rabbit Polyclonal Fas Ligand Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal IL1 alpha Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Pathways
- Graft-versus-host disease
Filter by
Target Symbol
- IL6 (144)
- CD80 (103)
- CD86 (62)
- TNF (60)
- IFNG (45)
- IL1A (38)
- CD28 (37)
- IL2 (36)
- IL1B (23)
- FAS (19)
- HLA-A (18)
- PRF1 (18)
- SMURF2 (18)
- GZMB (16)
- FASLG (13)
- HLA-DQA2 (13)
- KLRD1 (8)
- HLA-G (7)
- KLRC1 (7)
- HLA-DRB5 (6)
- KIR2DL3 (5)
- HLA-B (4)
- HLA-DRA (4)
- KIR3DL1 (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- HLA-E (3)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- KIR2DL1 (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- KIR2DL5A (1)
- KIR3DL2 (1)