Mouse Monoclonal AMPK alpha 1 Antibody (2B7)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal AMPK alpha 1 Antibody (2B7)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal RPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 900-950 of human Raptor was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-EIF4E2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY |
BRAF Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3C3
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700012 |
MAPK1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6F8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062 |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
Applications | ELISA, WB |
Reactivities | Human |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
Rabbit Monoclonal Antibody against CALM2 (Clone EP799Y)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Antibody against BRAF (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
Modifications | Phospho-specific |
Rabbit anti-MTOR polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit polyclonal FASN Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit anti-EIF4E Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EIF4E |
Rabbit Polyclonal Glut4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672] |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
Applications | WB |
Reactivities | Rat, Tobacco hornworm |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Mouse Monoclonal AKT(pan) Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal AKT1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal NRAS Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
KRAS mouse monoclonal antibody, clone AT2F8, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Rabbit Monoclonal Antibody against FRAP1 (Clone Y391)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PPP1CB (Clone EP1804Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Goat Polyclonal Antibody against Flotillin 1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794. |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit monoclonal antibody against IRS-2(clone EPR904(2))
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal NRAS Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
PCK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PCK1 |
Rabbit anti-PPP1CA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-AKT1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human AKT1 |
Mouse Monoclonal GSK-3 beta Antibody (3D10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SHC3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST |
Rabbit Polyclonal AKT2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
BRAF Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700011 |
SHC (SHC1) mouse monoclonal antibody, clone 3F4
Applications | ELISA, IF, IHC, PLA, WB |
Reactivities | Human |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 2F3, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Rabbit Polyclonal Antibody against FRAP1 (S2481)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1). |
Goat Polyclonal Antibody against SOCS1
Applications | FC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VLRDYLSSFPFQI, from the C Terminus of the protein sequence according to NP_003736.1. |
Rabbit monoclonal antibody against Phospho IRS-1 (pY896)(EP260Y) (Phospho-Specific)
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(Y387)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Raptor(EP539Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |