Antibodies

View as table Download

Rabbit anti-DLD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DLD

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Rabbit Polyclonal Anti-ACO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926)

IDH1 biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI24A2

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA600198

Rabbit Polyclonal SDHD Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD.

IDH1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2H9

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700199

Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390)

Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1.

Rabbit Polyclonal Anti-SDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Rabbit Polyclonal Anti-IDH3A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Rabbit anti-PDHA1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDHA1

Goat Polyclonal Anti-IDH3B (aa33-46) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1.

Goat Polyclonal Anti-IDH3A Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1.

Rabbit anti-IDH1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human IDH1

Rabbit anti-CS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CS

Rabbit Polyclonal Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

IDH1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI24A2

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700198

Rabbit anti-FH Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FH

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Rabbit Polyclonal Anti-MDH2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1.

Goat Polyclonal Anti-MDH1 / MOR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1.

PCK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PCK1

Rabbit Polyclonal Fumarase Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal antibody to Fumarate hydratase (fumarate hydratase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 365 of Fumarate hydratase (Uniprot ID#P07954)

Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912)

Rabbit Polyclonal antibody to SUCLG1 (succinate-CoA ligase, alpha subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 346 of SUCLG1 (Uniprot ID#P53597)

Goat Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CIHGLSNVKLNE, from the internal region of the protein sequence according to NP_002159.2.

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Antibody against ACO2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACO2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 294-325 amino acids from the Central region of human ACO2.

Rabbit Polyclonal Pyruvate Carboxylase Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498]

Rabbit polyclonal anti-PDHA1 antibody

Applications IHC, WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDHA1.

Mouse Anti-Human MDH2 Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

Anti-ACO2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 766-780 amino acids of human aconitase 2, mitochondrial

Rabbit polyclonal PC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PC.

Rabbit Polyclonal Anti-OGDH Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OGDH antibody: synthetic peptide directed towards the N terminal of human OGDH. Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Rabbit Polyclonal Anti-DLAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the C terminal of human DLAT. Synthetic peptide located within the following region: DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Rabbit Polyclonal Anti-IDH3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the middle region of human IDH3A. Synthetic peptide located within the following region: RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1.

Rabbit Polyclonal Anti-PDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Rabbit Polyclonal Anti-MDH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDH1 antibody: synthetic peptide directed towards the middle region of human MDH1. Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Goat Polyclonal Antibody against PCK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKEVEDIEKYLEDQ, from the internal region (near the C Terminus) of the protein sequence according to NP_002582.2.

Goat Anti-ACO1 / Aconitase 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVDFNRRADSLQKNQ, from the internal region of the protein sequence according to NP_002188.1.