Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 380.00
2 Weeks
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Clonalities
- Polyclonal
Families
- Druggable Genome
Citations
- Yes
Filter by
Category
Target Symbol
- CANX (6)
- BAX (3)
- PECAM1 (3)
- PPARGC1A (3)
- RAC1 (3)
- ABCC4 (2)
- ABCG2 (2)
- ADH5 (2)
- AOX1 (2)
- BAG3 (2)
- BDNF (2)
- BRAF (2)
- CALCRL (2)
- CASP9 (2)
- CCNA2 (2)
- CCR6 (2)
- CD4 (2)
- CD63 (2)
- CDH2 (2)
- COL1A1 (2)
- CTNNB1 (2)
- CTSD (2)
- FBXO17 (2)
- GAD1 (2)
- GJA1 (2)
- HMOX1 (2)
- IL18 (2)
- IRS1 (2)
- KDR (2)
- MAP3K5 (2)
- MAPK8 (2)
- MTNR1A (2)
- NFKB1 (2)
- NOS3 (2)
- PFKFB2 (2)
- RAB27A (2)
- RELA (2)
- SERPINA3 (2)
- SIGMAR1 (2)
- SLC2A1 (2)
- SPRY1 (2)
- STAT5A (2)
- TP63 (2)
- TSG101 (2)
- VCL (2)
- ABCB4 (1)
- ABCC2 (1)
- ABCC3 (1)
- ABCC5 (1)
- ABCC8 (1)
- ABCD2 (1)
- ABCD3 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AHCY (1)
- AICDA (1)
- AIMP1 (1)
- AKAP12 (1)
- AKR1B10 (1)
- AKT1 (1)
- ALPG (1)
- ANAPC10 (1)
- ANTXR1 (1)
- APAF1 (1)
- APP (1)
- AQP4 (1)
- ARSA (1)
- ARSB (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- AURKB (1)
- BAK1 (1)
- BARD1 (1)
- BCL2L10 (1)
- BCL2L2 (1)
- BDKRB1 (1)
- BECN1 (1)
- BID (1)
- BIRC3 (1)
- BLK (1)
- BRCA1 (1)
- BRCA2 (1)
- CACNA1C (1)
- CAMK1D (1)
- CASP8 (1)
- CAV1 (1)
- CCND2 (1)
- CCNE1 (1)
- CD19 (1)
- CD1E (1)
- CD274 (1)
- CD276 (1)
- CD44 (1)
- CD46 (1)
Applications
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (73)
- Focal adhesion (44)
- Metabolic pathways (41)
- MAPK signaling pathway (36)
- Neurotrophin signaling pathway (30)
- Pancreatic cancer (30)
- Regulation of actin cytoskeleton (29)
- Chemokine signaling pathway (28)
- Colorectal cancer (27)
- Toll-like receptor signaling pathway (26)
- Small cell lung cancer (25)
- Neuroactive ligand-receptor interaction (24)
- Prostate cancer (23)
- Apoptosis (22)
- Adipocytokine signaling pathway (21)
- Chronic myeloid leukemia (21)
- Cytokine-cytokine receptor interaction (21)
- Insulin signaling pathway (21)
- Leukocyte transendothelial migration (20)
- Adherens junction (19)
- Amyotrophic lateral sclerosis (ALS) (19)
- ErbB signaling pathway (19)
- Huntington's disease (19)
- Renal cell carcinoma (19)
- VEGF signaling pathway (18)
- p53 signaling pathway (18)
- Alzheimer's disease (17)
- Jak-STAT signaling pathway (17)
- Natural killer cell mediated cytotoxicity (17)
- T cell receptor signaling pathway (17)
- Wnt signaling pathway (17)
- Acute myeloid leukemia (16)
- B cell receptor signaling pathway (16)
- Cell adhesion molecules (CAMs) (16)
- NOD-like receptor signaling pathway (16)
- Progesterone-mediated oocyte maturation (16)
- Calcium signaling pathway (15)
- ECM-receptor interaction (15)
- Epithelial cell signaling in Helicobacter pylori infection (15)
- RIG-I-like receptor signaling pathway (15)
- Fc epsilon RI signaling pathway (14)
- Hematopoietic cell lineage (14)
- Melanoma (14)
- Bladder cancer (13)
- Cell cycle (13)
- Endometrial cancer (13)
- Fc gamma R-mediated phagocytosis (13)
- Gap junction (13)
- Glioma (13)
- Non-small cell lung cancer (13)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (12)
- Axon guidance (12)
- Endocytosis (12)
- Type II diabetes mellitus (12)
- Vascular smooth muscle contraction (12)
- ABC transporters (11)
- Lysosome (11)
- Pathogenic Escherichia coli infection (11)
- Antigen processing and presentation (10)
- GnRH signaling pathway (10)
- Viral myocarditis (10)
- Cytosolic DNA-sensing pathway (9)
- TGF-beta signaling pathway (9)
- mTOR signaling pathway (9)
- Long-term depression (8)
- Complement and coagulation cascades (7)
- Dilated cardiomyopathy (7)
- Long-term potentiation (7)
- Melanogenesis (7)
- Prion diseases (7)
- Thyroid cancer (7)
- Drug metabolism - cytochrome P450 (6)
- Fructose and mannose metabolism (6)
- Glycolysis / Gluconeogenesis (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Oocyte meiosis (6)
- PPAR signaling pathway (6)
- Parkinson's disease (6)
- Tight junction (6)
- Type I diabetes mellitus (6)
- Metabolism of xenobiotics by cytochrome P450 (5)
- Porphyrin and chlorophyll metabolism (5)
- Primary immunodeficiency (5)
- Tyrosine metabolism (5)
- Androgen and estrogen metabolism (4)
- Arginine and proline metabolism (4)
- Basal cell carcinoma (4)
- Butanoate metabolism (4)
- Fatty acid metabolism (4)
- Retinol metabolism (4)
- Starch and sucrose metabolism (4)
- Ubiquitin mediated proteolysis (4)
- Alanine (3)
- Dorso-ventral axis formation (3)
- Galactose metabolism (3)
- Homologous recombination (3)
- Linoleic acid metabolism (3)
- Purine metabolism (3)
- Regulation of autophagy (3)
- Sphingolipid metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Tryptophan metabolism (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Allograft rejection (2)
- Base excision repair (2)
- Citrate cycle (TCA cycle) (2)
- Cysteine and methionine metabolism (2)
- Drug metabolism - other enzymes (2)
- Folate biosynthesis (2)
- Glycerophospholipid metabolism (2)
- Glycosaminoglycan degradation (2)
- Graft-versus-host disease (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Phosphatidylinositol signaling system (2)
- Primary bile acid biosynthesis (2)
- Renin-angiotensin system (2)
- SNARE interactions in vesicular transport (2)
- Vitamin B6 metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Arachidonic acid metabolism (1)
- Ascorbate and aldarate metabolism (1)
- Autoimmune thyroid disease (1)
- C21-Steroid hormone metabolism (1)
- Cardiac muscle contraction (1)
- Circadian rhythm - mammal (1)
- DNA replication (1)
- Ether lipid metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Heparan sulfate biosynthesis (1)
- Inositol phosphate metabolism (1)
- Nucleotide excision repair (1)
- Olfactory transduction (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- Pentose and glucuronate interconversions (1)
- Pentose phosphate pathway (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyrimidine metabolism (1)
- Pyruvate metabolism (1)
- RNA polymerase (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Spliceosome (1)
- Steroid biosynthesis (1)
- Systemic lupus erythematosus (1)
- Thiamine metabolism (1)
- Vibrio cholerae infection (1)
- alpha-Linolenic acid metabolism (1)