Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop. |
Glucagon Receptor (GCGR) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 100-150 of Human Glucagon Receptor. |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Encephalopsin (OPN3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 176-220 of Human Encephalopsin. |
P2Y9 (LPAR4) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127-156 amino acids from the Central region of human P2RY9 / LPAR4 |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-P2Y12 Receptor (extracellular)
Applications | FC, IF, WB |
Reactivities | Human, Rat |
Immunogen | Peptide CTAENTLFYVKES, corresponding to amino acid residues 270-282 of human P2Y12 receptor. 3rd extracellular loop. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated |
Goat Polyclonal Antibody against Bradykinin receptor B1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2. |
Rabbit anti-SIGMAR1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal Anti-CALCRL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit polyclonal anti-FZD9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9. |
Rabbit polyclonal Encephalopsin antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Encephalopsin. |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Gorilla |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Rabbit polyclonal anti-MTR1A antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MTR1A. |
Rabbit polyclonal anti-CRHR1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CRHR1. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
CXCR4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Goat Anti-S1PR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Rabbit polyclonal anti-FSHR antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Rabbit Polyclonal GluR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
USD 450.00
2 Weeks
G protein coupled receptor 30 (GPER1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 345-375 amino acids from the C-terminal region of human GPER |
Carrier-free (BSA/glycerol-free) LGR5 mouse monoclonal antibody, clone OTI14E1 (formerly 14E1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-S1PR3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 222-236 amino acids of human sphingosine-1-phosphate receptor 3 |
Anti-MTNR1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A |
Anti-SSTR3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3 |
Rabbit Polyclonal Anti-CCR6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCR6 |
Rabbit Polyclonal Anti-CALCRL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CALCRL |
Rabbit Polyclonal Anti-GPER1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPER1 |
LGR5 mouse monoclonal antibody, clone OTI2H7 (formerly 2H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LGR5 mouse monoclonal antibody, clone OTI2H7 (formerly 2H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LGR5 mouse monoclonal antibody, clone OTI2A2
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LGR5 mouse monoclonal antibody, clone OTI2A2
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LGR5 mouse monoclonal antibody,clone UMAB212
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LGR5 mouse monoclonal antibody,clone UMAB210
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".