Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit Polyclonal Anti-DACH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DACH1 antibody: synthetic peptide directed towards the N terminal of human DACH1. Synthetic peptide located within the following region: MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASS |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit Polyclonal antibody to Rad54 (alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2161 and 2443 of Rad54 (Uniprot ID#P46100) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
WT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WT1 |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TSG101 Antibody is: synthetic peptide directed towards the N-terminal region of Human TSG101. Synthetic peptide located within the following region: YKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYR |
Active filters
Families
- Transcription Factors
Citations
- Yes
Filter by
Category
Target Symbol
- TP53 (9)
- CTNNB1 (6)
- SOX17 (5)
- ZEB1 (5)
- ARNTL (4)
- CDX2 (4)
- GATA4 (4)
- HIF1A (4)
- KEAP1 (4)
- NR4A3 (4)
- PARP1 (4)
- PRRX1 (4)
- RELA (4)
- SNAI2 (4)
- SQSTM1 (4)
- TP63 (4)
- ZEB2 (4)
- EPAS1 (3)
- HIF3A (3)
- PGR (3)
- POU5F1 (3)
- PPARGC1A (3)
- PRKAR1A (3)
- SEC14L2 (3)
- STAT3 (3)
- TNF (3)
- ARNT (2)
- CRABP2 (2)
- EGR2 (2)
- ESR1 (2)
- ETS2 (2)
- EZH2 (2)
- FOSL1 (2)
- FOXP3 (2)
- FOXQ1 (2)
- GSC (2)
- HDAC6 (2)
- HOXD10 (2)
- MDM4 (2)
- MITF (2)
- MYC (2)
- NDN (2)
- NFKB1 (2)
- PAX5 (2)
- PDX1 (2)
- REL (2)
- SATB1 (2)
- SIRT6 (2)
- SMURF2 (2)
- SOX9 (2)
- SSB (2)
- STAT5A (2)
- TGFB1 (2)
- TLE1 (2)
- TSG101 (2)
- TWIST2 (2)
- WWTR1 (2)
- ATRX (1)
- BCL6 (1)
- BRCA1 (1)
- CCNE1 (1)
- CD80 (1)
- CRK (1)
- CUX1 (1)
- DACH1 (1)
- DNMT1 (1)
- E2F1 (1)
- EBF1 (1)
- ERG (1)
- EZH1 (1)
- FOXC1 (1)
- FOXO1 (1)
- FOXO3 (1)
- FOXP1 (1)
- GAS7 (1)
- GATA3 (1)
- GATAD2B (1)
- GLI1 (1)
- HDAC9 (1)
- HEY2 (1)
- HEYL (1)
- HHEX (1)
- HNF4A (1)
- HOXA10 (1)
- HOXB7 (1)
- HOXC6 (1)
- HOXC8 (1)
- ILF2 (1)
- IRF3 (1)
- IRF7 (1)
- KCNH2 (1)
- LDB1 (1)
- LMO4 (1)
- MDM2 (1)
- MED6 (1)
- MTA3 (1)
- MYB (1)
- MYCN (1)
- MYOD1 (1)
- MZF1 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (51)
- Wnt signaling pathway (27)
- Chronic myeloid leukemia (25)
- MAPK signaling pathway (25)
- Prostate cancer (25)
- Pancreatic cancer (23)
- Apoptosis (21)
- Colorectal cancer (20)
- Small cell lung cancer (20)
- Endometrial cancer (18)
- Thyroid cancer (18)
- Cell cycle (17)
- Neurotrophin signaling pathway (17)
- Adipocytokine signaling pathway (16)
- Basal cell carcinoma (16)
- Huntington's disease (15)
- Acute myeloid leukemia (13)
- Bladder cancer (13)
- Melanoma (13)
- Renal cell carcinoma (13)
- Toll-like receptor signaling pathway (13)
- p53 signaling pathway (13)
- Amyotrophic lateral sclerosis (ALS) (12)
- Chemokine signaling pathway (12)
- Non-small cell lung cancer (12)
- Adherens junction (11)
- Glioma (11)
- RIG-I-like receptor signaling pathway (11)
- T cell receptor signaling pathway (11)
- TGF-beta signaling pathway (11)
- NOD-like receptor signaling pathway (9)
- Ubiquitin mediated proteolysis (9)
- B cell receptor signaling pathway (8)
- Cytosolic DNA-sensing pathway (8)
- Insulin signaling pathway (8)
- Jak-STAT signaling pathway (8)
- Melanogenesis (8)
- Focal adhesion (7)
- Tight junction (7)
- Allograft rejection (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Graft-versus-host disease (6)
- Leukocyte transendothelial migration (6)
- Pathogenic Escherichia coli infection (6)
- Systemic lupus erythematosus (6)
- Type I diabetes mellitus (6)
- Cytokine-cytokine receptor interaction (5)
- Dilated cardiomyopathy (5)
- Endocytosis (5)
- ErbB signaling pathway (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Maturity onset diabetes of the young (5)
- Natural killer cell mediated cytotoxicity (5)
- Type II diabetes mellitus (5)
- Base excision repair (4)
- Circadian rhythm - mammal (4)
- Metabolic pathways (4)
- Oocyte meiosis (4)
- mTOR signaling pathway (4)
- Alzheimer's disease (3)
- Asthma (3)
- Autoimmune thyroid disease (3)
- Cell adhesion molecules (CAMs) (3)
- Fc epsilon RI signaling pathway (3)
- Hematopoietic cell lineage (3)
- Progesterone-mediated oocyte maturation (3)
- Viral myocarditis (3)
- Antigen processing and presentation (2)
- Axon guidance (2)
- Dorso-ventral axis formation (2)
- VEGF signaling pathway (2)
- Cysteine and methionine metabolism (1)
- Fc gamma R-mediated phagocytosis (1)
- Hedgehog signaling pathway (1)
- Neuroactive ligand-receptor interaction (1)
- PPAR signaling pathway (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- RNA polymerase (1)
- Regulation of actin cytoskeleton (1)
- SNARE interactions in vesicular transport (1)