Goat Polyclonal Antibody against FOXC1
Applications | FC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1. |
Goat Polyclonal Antibody against FOXC1
Applications | FC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
TPM1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TPM1 |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
Applications | WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7) |
Rabbit polyclonal anti-TBP antibody, Loading control
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal EN2 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2. |
Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557) |
Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit Polyclonal Antibody against WIF1 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Goat Polyclonal Antibody against SMO (Internal region)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
UCP2 Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal METTL2 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2. |
Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb. |
Rabbit polyclonal SMAD2 Antibody
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2. |
Rabbit Polyclonal Anti-PTBP1 Antibody
Applications | WB |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Goat Polyclonal Anti-MNSOD (aa119-130) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Zebrafish, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1. |
Goat Polyclonal Anti-CDH11 Antibody
Applications | WB |
Reactivities | Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide fused with GST and produced in E. coli. |
Goat Polyclonal Anti-CDH11 Antibody
Applications | WB |
Reactivities | Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 752 aa to the C-terminus of CDH11 produced in E. coli. |
Rabbit Polyclonal Antibody against FGFR1 (Y653)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FGFR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 631-660 amino acids from human FGFR1. |
Goat Polyclonal Antibody against TCF2 / VHNF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1. |
Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829) |
Rabbit polyclonal antibody to RAB6A (RAB6A, member RAS oncogene family)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 208 of RAB6A (Uniprot ID#P20340) |
Rabbit polyclonal antibody to VPS11 (vacuolar protein sorting 11 homolog (S. cerevisiae))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 300 and 392 of VPS11 (Uniprot ID#Q9H270) |
Rabbit polyclonal antibody to CKS-2 (CDC28 protein kinase regulatory subunit 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 15 and 79 of CKS2 (Uniprot ID#P33552) |
Rabbit Polyclonal antibody to Importin 7 (importin 7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 976 and 1038 of Importin 7 (Uniprot ID#O95373) |
Rabbit Polyclonal antibody to RanBP16 (exportin 7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 902 and 1087 of RanBP16 (Uniprot ID#Q9UIA9) |
Rabbit Polyclonal antibody to GIPC1 (GIPC PDZ domain containing family, member 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 273 and 333 of GIPC1 |
Rabbit polyclonal antibody to DMC1 (DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of DMC1 (Uniprot ID#Q14565) |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit polyclonal antibody to PSR (jumonji domain containing 6)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of PSR (Uniprot ID#Q6NYC1) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to DOCK1 (dedicator of cytokinesis 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1802 and 1865 of DOCK1 |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histone H2A.Z |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
Rabbit Polyclonal ZMPSTE24 Antibody
Applications | WB |
Reactivities | Human, Mouse, Primate, Zebrafish |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human ZMPSTE24 protein sequence (between residues 1-100). [Swiss-Prot O75844] |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%). |
Rabbit polyclonal beta Catenin antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal Anti-RAB5B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |