Rabbit Polyclonal Anti-ACAT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Rabbit Polyclonal Anti-ACOT12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOT12 antibody: synthetic peptide directed towards the middle region of human ACOT12. Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV |
GLO1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GLO1 |
MDH1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human MDH1 |
MDH2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MDH2 |
ME1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
PKM2 (PKM) (36-40) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa. 36~40 |
PKM2 (PKM) (36-40) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa. 36~40 |
LDHAL6A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 157-187 amino acids from the Central region of Human LDHAL6A |
PDHA1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 233~263 amino acids from the Central region of Human PDHA1 |
Goat Polyclonal Antibody against LDHC (aa 217 - 231)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLGTDSDKEHWKNIH, from the Internal region of the protein sequence according to NP_002292.1; NP_059144.1. |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Goat Polyclonal Antibody against Pyruvate Carboxylase
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit anti-ACAT1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Porcine, Rat, Murine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
Goat Anti-ALDH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEQFERVLGYIQ, from the interral region of the protein sequence according to NP_000683.3. |
Goat Anti-ACACB Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLGEPDLSDKDRKD, from the internal region of the protein sequence according to NP_001084.2. |
Rabbit polyclonal anti-PEPCK-C antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Anti-PDHA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-390 amino acids of human pyruvate dehydrogenase (lipoamide) alpha 1 |
Anti-ACACA (Phospho-Ser79) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 79(S-M-S(p)-G-L) derived from Human Acetyl-CoA Carboxylase. |
| Modifications | Phospho-specific |
Anti-ACACA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.78-82(S-M-S-G-L) derived from Human Acetyl-CoA Carboxylase. |
Anti-LDHB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human LDHB |
Phospho-PKM2-S37 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S37 of human PKM2 |
LDHA Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C Terminus (SDLVKVTLTSE) |
LDHB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (near N terminus) (EEATVPNNKIT) |
Rabbit Polyclonal Anti-ME1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ME1 antibody is: synthetic peptide directed towards the C-terminal region of Human ME1. Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Anti-HAGHL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HAGHL Antibody is: synthetic peptide directed towards the C-terminal region of Human HAGHL. Synthetic peptide located within the following region: PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA |
Phospho-ACACA-S79 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S79 of human ACACA |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACYP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK |
Rabbit Polyclonal Anti-HAGH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAGH antibody: synthetic peptide directed towards the C terminal of human HAGH. Synthetic peptide located within the following region: FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
Rabbit Polyclonal Anti-LDHAL6B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHAL6B Antibody: synthetic peptide directed towards the middle region of human LDHAL6B. Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA |
Rabbit Polyclonal Anti-PDHA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG |
Rabbit Polyclonal Anti-LDHD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDHD antibody: synthetic peptide directed towards the middle region of human LDHD. Synthetic peptide located within the following region: LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV |
Rabbit Polyclonal Anti-ME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG |
Rabbit Polyclonal Anti-ALDH9A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC |
Rabbit Polyclonal Anti-PC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |
Rabbit Polyclonal Anti-ACSS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSS1 antibody is: synthetic peptide directed towards the middle region of Human ACSS1. Synthetic peptide located within the following region: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS |
Goat Anti-ALDH9A1, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3. |
Anti-PC Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Anti-PC Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase |
Anti-PKM2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2 |
Anti-AKR1B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
