Antibodies

View as table Download

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit Polyclonal Anti-THOC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Rabbit anti-HNRNPK Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HNRNPK

Rabbit Polyclonal CTTNBL1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1.

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF

Rabbit Polyclonal Anti-SNRPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the middle region of human SNRPD2. Synthetic peptide located within the following region: ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG

Rabbit Polyclonal Anti-PCBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF

Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A

Rabbit Polyclonal Anti-SF3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1. Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1. Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Rabbit Polyclonal Anti-RBM8A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM8A antibody: synthetic peptide directed towards the N terminal of human RBM8A. Synthetic peptide located within the following region: LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDS

Rabbit anti-PRPF3 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRPF3

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-RBM22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Rabbit Polyclonal Anti-LSM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Rabbit Polyclonal Anti-THOC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT

Rabbit Polyclonal Anti-FUSIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS

Rabbit Polyclonal Anti-HNRPA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS

Rabbit Polyclonal Anti-HNRPA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: PGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE

Rabbit Polyclonal Anti-SF3B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the middle region of human SF3B1. Synthetic peptide located within the following region: LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the C terminal of human HNRPA1. Synthetic peptide located within the following region: NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS

Rabbit Polyclonal Anti-SFRS10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Rabbit Polyclonal Anti-SNRPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Rabbit Polyclonal Anti-SNRPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the N terminal of human SNRPD2. Synthetic peptide located within the following region: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

Goat Polyclonal Antibody against PRPF31

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2.

Rabbit anti-U2AF2 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human U2AF2

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Rabbit Polyclonal Anti-SNRPD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Rabbit polyclonal anti-SFRS7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS7.

Rabbit polyclonal Hsp70 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa)
Conjugation Unconjugated
Immunogen Full length human protein Hsp70

Rabbit Polyclonal Anti-LSM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Rabbit Polyclonal Anti-SFRS2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS2B antibody: synthetic peptide directed towards the middle region of human SFRS2B. Synthetic peptide located within the following region: YRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSA

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Rabbit Polyclonal Anti-RP11-78J21.1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Rabbit Polyclonal Anti-RP11-78J21.1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Rabbit Polyclonal Anti-HNRPK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the C terminal of human HNRPK. Synthetic peptide located within the following region: YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS

Rabbit Polyclonal Anti-HNRPK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the N terminal of human HNRPK. Synthetic peptide located within the following region: NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG

Rabbit Polyclonal Anti-SNRP70 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the C terminal of human SNRP70. Synthetic peptide located within the following region: RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR

Rabbit Polyclonal Anti-SNRPF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF. Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the middle region of human SMNDC1. Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT

Rabbit Polyclonal Anti-PPIE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

U2AF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human U2AF1

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ