Antibodies

View as table Download

Rabbit polyclonal anti-OR52A4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52A4.

Rabbit polyclonal CYP3A5 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5.

Rabbit Polyclonal TK (Ser13) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TK around the phosphorylation site of Serine 13
Modifications Phospho-specific

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR

Rabbit Polyclonal Anti-CYP3A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A5 antibody: synthetic peptide directed towards the N terminal of human CYP3A5. Synthetic peptide located within the following region: AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL

Rabbit Polyclonal antibody to NAT1 (N-acetyltransferase 1 (arylamine N-acetyltransferase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of NAT1 (Uniprot ID#P18440)

Rabbit Polyclonal antibody to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of NAT2 (Uniprot ID#P11245)

Rabbit polyclonal Cytochrome P450 3A4/5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A4/5.

Rabbit polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CES2.

Mouse monoclonal CDA Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal TK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TK

Goat Anti-NAT1 (aa272-286) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NISLQRKLVPKHGDR, from the C Terminus of the protein sequence according to NP_000653.3; NP_001153647.1.

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE

Rabbit Polyclonal Anti-IMPDH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH1 Antibody is: synthetic peptide directed towards the C-terminal region of IMPDH1. Synthetic peptide located within the following region: DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

Rabbit Polyclonal Anti-CYP2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A6 antibody is: synthetic peptide directed towards the C-terminal region of Human CYP2A6. Synthetic peptide located within the following region: MEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRD

Rabbit Polyclonal Anti-CDA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ

Goat Anti-IMPDH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KEEEHDCFLEEI, from the internal region of the protein sequence according to NP_000875.2.

Rabbit polyclonal Thymidine Kinase 1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TK.
Modifications Phospho-specific

Rabbit polyclonal KITH_HHV1C antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TK.

Rabbit polyclonal Cytochrome P450 3A43 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43.

Anti-NAT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Mouse monoclonal CDA Antibody (Center)(Ascites)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-UGT1A9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Rabbit Polyclonal anti-CES2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES2 antibody: synthetic peptide directed towards the middle region of human CES2. Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG

Rabbit Polyclonal Anti-UCKL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UCKL1 antibody is: synthetic peptide directed towards the N-terminal region of Human UCKL1. Synthetic peptide located within the following region: PSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKRT

Rabbit polyclonal Anti-UGT1A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM

Rabbit Polyclonal Anti-NAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT2 antibody: synthetic peptide directed towards the middle region of human NAT2. Synthetic peptide located within the following region: CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE

Rabbit Polyclonal Anti-NAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT2 antibody is: synthetic peptide directed towards the C-terminal region of Human NAT2. Synthetic peptide located within the following region: TPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLG

Rabbit Polyclonal Anti-NAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT2 antibody: synthetic peptide directed towards the middle region of human NAT2. Synthetic peptide located within the following region: TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the C terminal of human IMPDH2. Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR

Rabbit Polyclonal Anti-UGT2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Rabbit Polyclonal Anti-UGT2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR

Rabbit Polyclonal Anti-CYP3A4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI

Rabbit Polyclonal Anti-CYP3A4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the middle region of human CES7. Synthetic peptide located within the following region: LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF

Rabbit Polyclonal Anti-UGT1A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Rabbit Polyclonal Anti-TMEM158 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Rabbit Polyclonal Anti-CYP2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2A6 antibody: synthetic peptide directed towards the C terminal of human CYP2A6. Synthetic peptide located within the following region: AFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKH

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS