Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 380.00
In Stock
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Active filters
Families
- Druggable Genome
Pathways
- Chemokine signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- AKT1 (127)
- BRAF (100)
- MAPK1 (74)
- PIK3CG (64)
- KRAS (58)
- RELA (54)
- STAT1 (52)
- PXN (49)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- IKBKG (41)
- PTK2 (41)
- NFKB1 (36)
- JAK2 (35)
- PIK3CD (35)
- FOXO3 (34)
- RAF1 (33)
- STAT3 (33)
- SHC1 (32)
- BCAR1 (30)
- NFKBIA (30)
- CCL2 (27)
- CHUK (26)
- CXCL8 (26)
- PAK1 (26)
- PIK3CA (25)
- ARRB1 (23)
- CXCR4 (23)
- MAPK3 (23)
- WASL (21)
- GSK3B (20)
- IKBKB (20)
- AKT3 (19)
- GSK3A (19)
- PRKCD (19)
- STAT5B (18)
- CCL19 (17)
- NRAS (17)
- CCL5 (16)
- CXCL12 (16)
- GRK1 (15)
- ROCK2 (15)
- DOCK2 (14)
- GRK4 (14)
- JAK3 (14)
- PIK3R1 (14)
- PRKCB (12)
- CCL3 (11)
- CCR5 (11)
- CCR7 (11)
- GRB2 (11)
- CCL11 (10)
- CCL27 (10)
- CX3CR1 (10)
- GNAI1 (10)
- GRK2 (10)
- STAT2 (10)
- VAV1 (10)
- CXCL10 (9)
- CXCR2 (9)
- CXCR3 (9)
- GRK5 (9)
- PTK2B (9)
- RHOA (9)
- CCL20 (8)
- CCL28 (8)
- CCL7 (8)
- CCR8 (8)
- CRK (8)
- CSK (8)
- PRKACA (8)
- PRKCZ (8)
- CCR3 (7)
- CCR4 (7)
- CRKL (7)
- CX3CL1 (7)
- LYN (7)
- PF4 (7)
- ROCK1 (7)
- CXCL1 (6)
- FGR (6)
- GRK3 (6)
- RAC1 (6)
- RAP1A (6)
- CCR1 (5)
- CDC42 (5)
- CXCL14 (5)
- CXCR1 (5)
- CXCR6 (5)
- GNG7 (5)
- HCK (5)
- PPBP (5)
- WAS (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- ARRB2 (4)
- CCL16 (4)
Reactivities
- Human (2070)
- Mouse (1631)
- Rat (1529)
- Dog (361)
- Monkey (357)
- Bovine (32)
- Chicken (21)
- Pig (14)
- Cow (9)
- Canis (8)
- Xenopus (8)
- Primate (7)
- Rabbit (7)
- Gorilla (6)
- Hamster (6)
- Canine (5)
- Drosophila (4)
- Gibbon (4)
- Rhesus Monkey (4)
- Chimpanzee (2)
- Equine (2)
- Horse (2)
- Sheep (2)
- X. tropicalis (2)
- C. elegans (1)
- Guinea Pig (1)
- Macaque (1)
- Porcine (1)