FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A |
FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A |
Mouse Monoclonal anti-P53 Antibody
Applications | IHC, WB |
Reactivities | Human, non-human primates |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-E2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3. |
Rabbit polyclonal antibody to E2F1 (E2F transcription factor 1)
Applications | IF, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 133 and 362 of E2F1 (Uniprot ID#Q01094) |
Rabbit Polyclonal p53 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit monoclonal antibody against FOXO3a(clone EPR1950)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Phospho-RB1-S780 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S780 of human RB1 |
Modifications | Phospho-specific |
FOXO3 (661-673) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep |
Immunogen | Synthetic peptide from C Terminus of human FKHRL1 / FOXO3A |
Rabbit monoclonal antibody against Rb (clone EP44(2) )
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal Anti-RARB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RARB |
Rabbit Polyclonal Anti-RB1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RB1 |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
E2F2 (202-252) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide, corresponding to amino acids 202-252 of Human E2F-2. |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit anti-RB1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RB1 |
Mouse Monoclonal E2F-1 Antibody
Applications | IF, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
Applications | FC, IHC, IP, WB |
Reactivities | Human |
FOXO3 (361-460) mouse monoclonal antibody, clone 2H2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
FOXO3 (361-460) mouse monoclonal antibody, clone 4F2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
FOXO3 (361-460) mouse monoclonal antibody, clone 2C5, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
FOXO3 pSer253 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
FOXO3 pSer253 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human FOXO3A around the phosphorylation site of Serine 253. |
FOXO3 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | FOXO3 antibody was raised against synthetic peptide - KLH conjugated |
Rabbit polyclonal Retinoic Acid Receptor beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β. |
Rabbit polyclonal Retinoblastoma (Ser608) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V). |
Modifications | Phospho-specific |
Anti-RB1 (Phospho-Ser795) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 795 (P-S-S(p)-P-L) derived from Human Rb. |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser20) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 20 |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 (Ser392) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p53 around the phosphorylation site of Serine 392 |
Modifications | Phospho-specific |
Rabbit polyclonal p53 (Ab-15) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15. |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-p53-Acetylated (Lys382) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Modified peptide |
Rabbit Polyclonal Anti-RXRG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-RXRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-p53 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 Antibody: A synthesized peptide derived from human p53 |
Rabbit Polyclonal Anti-E2F-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Rabbit Polyclonal Anti-E2F-2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F-2 Antibody: Peptide sequence around aa.425~429(L-F-D-S-Y) derived from Human E2F-2. |
Rabbit Polyclonal Anti-Phospho-Retinoblastoma(Thr826) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-Retinoblastoma(Thr826) Antibody: A synthesized peptide derived from human Retinoblastoma around the phosphorylation site of Threonine 826 |
Modifications | Phospho-specific |
p53 (TP53) mouse monoclonal antibody, clone IMD-53, Purified
Applications | IF, IHC, WB |
Reactivities | Human |
FOXO3 (361-460) mouse monoclonal antibody, clone 4E8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
FOXO3 (361-460) mouse monoclonal antibody, clone 3C2, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ. |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |