Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Anti-CD36 mouse mAb, clone OTI4H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI3F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-CD36 mouse mAb, clone OTI3F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI4H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit Polyclonal Anti-CPT1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA |
Rabbit Polyclonal Anti-NPY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP |
Goat Anti-CPT1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1. |
Rabbit anti-CD36 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD36 |
USD 480.00
2 Weeks
Leptin Receptor (LEPR) (829-841) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide C-TQDDIEKHQSDAG from an internal region of human LEPR / Leptin Receptor (NP_002294.2; NP_001003679.1; NP_001003680.1). aa829-841 |
Rabbit polyclonal ADIPOR1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADIPOR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 305-331 amino acids from the C-terminal region of human ADIPOR1. |
Rabbit anti-TNFRSF1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFRSF1B |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ACSL6. Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS |
Rabbit Polyclonal Anti-TNF-R2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNF-R2 Antibody: A synthesized peptide derived from human TNF-R2 |
Rabbit Polyclonal Anti-TNF-R2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNF-R2 Antibody: A synthesized peptide derived from human TNF-R2 |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
Goat Polyclonal Antibody against Leptin Receptor
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TQDDIEKHQSDAG, from the internal region of the protein sequence according to NP_002294.2; NP_001003679.1; NP_001003680.1. |
Active filters
Families
- Transmembrane
Pathways
- Adipocytokine signaling pathway