Germany
Japan
United Kingdom
China
Antibodies
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-LGR5 mouse mAb, clone OTI2A2, DyLight 488 conjugated
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | DyLight 488 |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
USD 399.00
In Stock
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
Active filters
Families
- Transmembrane
Filter by
Target Symbol
- KLK8 (256)
- ERBB2 (239)
- CD4 (232)
- PDCD1 (220)
- CD5 (208)
- EGFR (207)
- ABCB1 (168)
- PECAM1 (148)
- CD274 (131)
- CD68 (131)
- HAVCR2 (126)
- MSMB (126)
- CD40 (125)
- CD99 (121)
- PTPRC (120)
- APP (111)
- IL1RL1 (109)
- CD44 (105)
- CD80 (103)
- EPCAM (102)
- BCL2 (99)
- CTLA4 (99)
- MLANA (99)
- CD47 (98)
- CD63 (98)
- L1CAM (96)
- KIT (93)
- BTLA (90)
- MS4A1 (90)
- TNFRSF8 (89)
- CD19 (86)
- CD33 (84)
- LGR5 (84)
- PDCD1LG2 (80)
- CD27 (76)
- TIGIT (75)
- NCAM1 (74)
- PROCR (74)
- ERBB3 (73)
- SPG7 (72)
- CD163 (71)
- SYP (71)
- BSG (69)
- CDH1 (69)
- PTPRE (69)
- TNFRSF9 (69)
- CD8A (68)
- ICOS (68)
- CD1C (67)
- FGFR2 (66)
- FOLH1 (66)
- CD34 (65)
- CD22 (64)
- MET (64)
- MUC1 (64)
- FCGR2A (63)
- PDGFRA (63)
- RNF144B (63)
- CD86 (62)
- FGG (62)
- HP (62)
- MSR1 (62)
- LAG3 (61)
- RET (61)
- MCL1 (60)
- TNF (60)
- PCDH7 (59)
- NPR3 (58)
- CR2 (57)
- CYP1A2 (57)
- MSLN (56)
- SDC1 (56)
- NGFR (55)
- CD2 (54)
- FATE1 (54)
- FBXW7 (53)
- KDR (53)
- SLC2A5 (53)
- VCAM1 (53)
- PMEL (52)
- RPN1 (51)
- BTN1A1 (50)
- PDGFRB (50)
- PDIA4 (50)
- ANO1 (49)
- GOLM1 (49)
- GPNMB (49)
- ACE2 (48)
- APMAP (48)
- FCER2 (48)
- MTDH (48)
- CD14 (47)
- CDCP1 (47)
- LRRC25 (47)
- POR (47)
- SYT4 (47)
- WNT3 (47)
- ENG (46)
- ICAM3 (46)
- TAPBPL (46)
Species
Reactivities
- Human (21973)
- Mouse (8234)
- Rat (7378)
- Monkey (746)
- Dog (734)
- Bovine (251)
- Pig (196)
- Rabbit (145)
- Cow (137)
- Gorilla (136)
- Hamster (118)
- Horse (105)
- Gibbon (102)
- Bat (90)
- Chicken (71)
- Canine (58)
- Primate (52)
- Xenopus (49)
- Chimpanzee (43)
- Guinea Pig (34)
- Rhesus Monkey (32)
- Zebrafish (32)
- Orang-Utan (29)
- Porcine (24)
- Sheep (21)
- X. tropicalis (9)
- Macaque (8)
- Drosophila (7)
- Opossum (7)
- Feline (6)
- Equine (5)
- Baboon (4)
- Goat (4)
- Quail (3)
- Avian (2)
- Fish (2)
- Canis (1)
- Eukaryote (1)
- Marmoset (1)
- Mink (1)
- Murine (1)
- Mustelid (1)
- Pufferfish (1)
- Squirrel (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Vectors
Modifications
Mutants
Assay Types
Assay Platforms
Mammalian Cell Selection
Pathways
- Cell adhesion molecules (CAMs) (2946)
- Cytokine-cytokine receptor interaction (2589)
- Hematopoietic cell lineage (2166)
- Pathways in cancer (1810)
- Neuroactive ligand-receptor interaction (1288)
- Metabolic pathways (1245)
- Calcium signaling pathway (1180)
- Endocytosis (1108)
- Focal adhesion (1097)
- T cell receptor signaling pathway (980)
- Prostate cancer (845)
- Regulation of actin cytoskeleton (814)
- MAPK signaling pathway (806)
- Primary immunodeficiency (792)
- Adherens junction (773)
- Colorectal cancer (665)
- ErbB signaling pathway (653)
- Leukocyte transendothelial migration (646)
- Systemic lupus erythematosus (615)
- Melanoma (614)
- Toll-like receptor signaling pathway (599)
- Bladder cancer (596)
- Pancreatic cancer (570)
- Endometrial cancer (553)
- Autoimmune thyroid disease (545)
- Jak-STAT signaling pathway (513)
- Allograft rejection (512)
- Viral myocarditis (510)
- Alzheimer's disease (504)
- Apoptosis (490)
- Non-small cell lung cancer (490)
- ECM-receptor interaction (481)
- Antigen processing and presentation (477)
- Gap junction (468)
- Olfactory transduction (450)
- Natural killer cell mediated cytotoxicity (449)
- Axon guidance (425)
- Lysosome (408)
- Epithelial cell signaling in Helicobacter pylori infection (403)
- Glioma (393)
- Graft-versus-host disease (381)
- Type I diabetes mellitus (381)
- Melanogenesis (342)
- ABC transporters (333)
- Amyotrophic lateral sclerosis (ALS) (332)
- Dilated cardiomyopathy (317)
- Hypertrophic cardiomyopathy (HCM) (300)
- B cell receptor signaling pathway (297)
- Neurotrophin signaling pathway (296)
- GnRH signaling pathway (292)
- Fc gamma R-mediated phagocytosis (283)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (282)
- Asthma (269)
- Chemokine signaling pathway (250)
- Huntington's disease (235)
- Basal cell carcinoma (233)
- Adipocytokine signaling pathway (227)
- Parkinson's disease (227)
- Dorso-ventral axis formation (218)
- Drug metabolism - cytochrome P450 (218)
- Complement and coagulation cascades (215)
- Renin-angiotensin system (205)
- Small cell lung cancer (204)
- Retinol metabolism (191)
- Hedgehog signaling pathway (186)
- SNARE interactions in vesicular transport (185)
- Wnt signaling pathway (183)
- Pathogenic Escherichia coli infection (179)
- TGF-beta signaling pathway (172)
- Tight junction (167)
- Oxidative phosphorylation (164)
- Metabolism of xenobiotics by cytochrome P450 (155)
- Linoleic acid metabolism (154)
- Vascular smooth muscle contraction (154)
- RIG-I-like receptor signaling pathway (152)
- Thyroid cancer (148)
- N-Glycan biosynthesis (142)
- Prion diseases (139)
- Cardiac muscle contraction (137)
- PPAR signaling pathway (135)
- Renal cell carcinoma (121)
- Acute myeloid leukemia (118)
- Arachidonic acid metabolism (117)
- Tryptophan metabolism (115)
- Sphingolipid metabolism (113)
- NOD-like receptor signaling pathway (112)
- Long-term potentiation (110)
- Purine metabolism (109)
- p53 signaling pathway (108)
- Ubiquitin mediated proteolysis (107)
- Long-term depression (105)
- Vibrio cholerae infection (105)
- Caffeine metabolism (104)
- Fatty acid metabolism (103)
- Type II diabetes mellitus (99)
- Drug metabolism - other enzymes (96)
- Fc epsilon RI signaling pathway (96)
- Porphyrin and chlorophyll metabolism (92)
- Notch signaling pathway (82)
- Chronic myeloid leukemia (80)
- Glycerolipid metabolism (80)
- Nicotinate and nicotinamide metabolism (76)
- Androgen and estrogen metabolism (69)
- Insulin signaling pathway (65)
- Progesterone-mediated oocyte maturation (65)
- Taste transduction (65)
- Cytosolic DNA-sensing pathway (64)
- Glycerophospholipid metabolism (64)
- Glycosphingolipid biosynthesis - lacto and neolacto series (63)
- Pyrimidine metabolism (62)
- VEGF signaling pathway (62)
- Ascorbate and aldarate metabolism (61)
- Nitrogen metabolism (61)
- Tyrosine metabolism (59)
- Oocyte meiosis (57)
- Glutathione metabolism (55)
- O-Glycan biosynthesis (52)
- Starch and sucrose metabolism (52)
- Keratan sulfate biosynthesis (51)
- Glycolysis / Gluconeogenesis (45)
- Riboflavin metabolism (45)
- Propanoate metabolism (44)
- Ether lipid metabolism (43)
- Valine (43)
- beta-Alanine metabolism (43)
- leucine and isoleucine degradation (43)
- Arginine and proline metabolism (42)
- Histidine metabolism (42)
- Other glycan degradation (42)
- Biosynthesis of unsaturated fatty acids (41)
- Lysine degradation (39)
- Limonene and pinene degradation (38)
- Pyruvate metabolism (38)
- Butanoate metabolism (37)
- Heparan sulfate biosynthesis (36)
- Chondroitin sulfate biosynthesis (35)
- Primary bile acid biosynthesis (32)
- Pentose and glucuronate interconversions (28)
- Amino sugar and nucleotide sugar metabolism (27)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (27)
- Steroid biosynthesis (26)
- Galactose metabolism (23)
- Glycosphingolipid biosynthesis - ganglio series (18)
- Glycosphingolipid biosynthesis - globo series (15)
- Cell cycle (13)
- Glycine (13)
- Glycosaminoglycan degradation (13)
- serine and threonine metabolism (13)
- C21-Steroid hormone metabolism (12)
- Phenylalanine metabolism (12)
- Phosphatidylinositol signaling system (12)
- Protein export (11)
- alpha-Linolenic acid metabolism (11)
- Pantothenate and CoA biosynthesis (10)
- Cyanoamino acid metabolism (8)
- Selenoamino acid metabolism (8)
- Taurine and hypotaurine metabolism (8)
- Inositol phosphate metabolism (7)
- Base excision repair (5)
- O-Mannosyl glycan biosynthesis (5)
- Sulfur metabolism (5)
- Maturity onset diabetes of the young (4)
- Terpenoid backbone biosynthesis (2)
- Citrate cycle (TCA cycle) (1)
- Fatty acid biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)