Antibodies

View as table Download

Rabbit Polyclonal DNA Polymerase beta Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human DNA Polymerase beta.

Rabbit polyclonal APEX1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APEX1.

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit Polyclonal HMGB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HMGB1.

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Rabbit Polyclonal MYH Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

APE1 (APEX1) rabbit polyclonal antibody, Serum

Applications IHC, WB
Reactivities Human

PARP1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide for the N-terminal region of human PARP.

Goat Polyclonal Antibody against APE1 / APEX1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PKRGKKGAVAEDGD-C, from the N Terminus of the protein sequence according to NP_001632.2; NP_542379.1; NP_542380.1.

Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340)

Rabbit polyclonal anti-POLD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD1.

Rabbit polyclonal anti-MUTYH antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MUTYH.

Rabbit polyclonal anti-TDG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TDG.

Rabbit polyclonal anti-PARP2 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARP2.

Rabbit Polyclonal UNG2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen UNG2 antibody was raised against a 17 amino acid peptide near the amino terminus of human UNG2.

Anti-OGG1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal FEN1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1.

Rabbit polyclonal POLE3 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3.

Rabbit polyclonal PARP (Cleaved-Asp214) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PARP.

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP

Rabbit Polyclonal Anti-MBD4 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT

Goat Polyclonal Antibody against MUTYH

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HISTDAHSLNSAAQ, from the C Terminus of the protein sequence according to NP_036354.1; NP_001041636.1; NP_001041637.1; NP_001041638.1; NP_001041639.1.

Goat Polyclonal Antibody against MPG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVVDRVAEQDTQA, from the C Terminus of the protein sequence according to NP_002425.2; NP_001015052.1; NP_001015054.1.

Goat Anti-NEIL1 / NEH1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DIPSLEPEGTSAS, from the C Terminus of the protein sequence according to NP_078884.2.

Goat Anti-POLL / BETA-N Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1.

Goat Anti-LIG1 / DNA ligase I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1.

Rabbit polyclonal anti-NEIL1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NEIL1.

Rabbit polyclonal anti-PARP4 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PARP4.

Rabbit polyclonal anti-DNL3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human LIG3

Rabbit polyclonal anti-POLD3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD3.

Rabbit polyclonal anti-MBD4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 474 of mouse MBD4

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Algal
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 55-71 of Isochrysis galbana PCNA.

Rabbit polyclonal anti-POLB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptidecorresponding to a region near the C-terminus of the POLβ protein.

Anti-LIG3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human ligase III, DNA, ATP-dependent

Rabbit polyclonal PARP3 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PARP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-126 amino acids from the N-terminal region of human PARP3.

Rabbit polyclonal POLD2 Antibody (Center)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2.

Rabbit Polyclonal Anti-XRCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-XRCC1 antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC1. Synthetic peptide located within the following region: GDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLP

Rabbit Polyclonal Anti-POLE3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS

Rabbit Polyclonal Anti-PARP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP1 antibody: synthetic peptide directed towards the C terminal of human PARP1. Synthetic peptide located within the following region: ISRLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVIDTSLLYN

Rabbit Polyclonal Anti-PARP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD

Rabbit Polyclonal Anti-POLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV

Rabbit Polyclonal Anti-POLL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLL antibody: synthetic peptide directed towards the middle region of human POLL. Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Rabbit Polyclonal Anti-SMUG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMUG1 antibody: synthetic peptide directed towards the middle region of human SMUG1. Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Rabbit Polyclonal Anti-MPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the middle region of human MPG. Synthetic peptide located within the following region: QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS

Rabbit Polyclonal Anti-MPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MPG Antibody: synthetic peptide directed towards the C terminal of human MPG. Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Rabbit Polyclonal Anti-LIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Rabbit Polyclonal Anti-LIG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF

Rabbit Polyclonal Anti-POLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLB antibody: synthetic peptide directed towards the middle region of human POLB. Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Rabbit Polyclonal Anti-NTHL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS