Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit monoclonal anti-PDIA3 antibody for SISCAPA, clone OTIR5G4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Goat Polyclonal Antibody against HSPA8 (Isoform 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1. |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Rabbit Polyclonal Anti-NFYC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYC antibody: synthetic peptide directed towards the C terminal of human NFYC. Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to KLRC1 (killer cell lectin-like receptor subfamily C, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of KLRC1 (Uniprot ID#P26715) |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-CD74 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD74 |
Rabbit Polyclonal Anti-HSP90AA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSP90AA1 |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
HSPA1L Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSPA1L |
Rabbit anti-HSPA1A Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | N term –peptide of human HSPA1A |
Active filters
Isotypes
- IgG
Pathways
- Antigen processing and presentation
Filter by
Category
Target Symbol
- CREB1 (22)
- HSP90AB1 (12)
- CALR (10)
- CANX (8)
- HSP90AA1 (8)
- HSPA1A (8)
- PDIA3 (7)
- B2M (6)
- CD4 (5)
- HSPA8 (5)
- KIR2DL3 (5)
- NFYA (5)
- CD74 (4)
- CD8A (4)
- CD8B (4)
- CIITA (4)
- CTSL (4)
- HSPA5 (4)
- KIR3DL1 (4)
- KLRC1 (4)
- NFYB (4)
- NFYC (4)
- PSME2 (4)
- PSME3 (4)
- TAP2 (4)
- CTSB (3)
- HSPA4 (3)
- LGMN (3)
- PSME1 (3)
- RFX5 (3)
- CTSS (2)
- HLA-A (2)
- HLA-DMA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DQA2 (2)
- HLA-DRA (2)
- HLA-DRB3 (2)
- HLA-F (2)
- HSPA1L (2)
- HSPA6 (2)
- IFI30 (2)
- IFNA16 (2)
- IFNA2 (2)
- IFNA4 (2)
- LTA (2)
- RFXAP (2)
- SMURF2 (2)
- HLA-B (1)
- HLA-DMB (1)
- HLA-DOA (1)
- HLA-DPB1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HLA-G (1)
- HSPA2 (1)
- IFNA13 (1)
- IFNA5 (1)
- IFNA6 (1)
- IFNA7 (1)
- IFNA8 (1)
- KIR2DL1 (1)
- KIR2DL4 (1)
- KIR2DL5A (1)
- KIR3DL2 (1)
- KLRC4 (1)
- KLRD1 (1)
- TAP1 (1)
- TAPBP (1)