Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Goat Anti-Sprouty Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPSRGQGKPS, from the C Terminus of the protein sequence according to NP_005832.1; NP_955359.1. |
USD 515.00
In Stock
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
CBLB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBLB |
Rabbit Polyclonal Anti-CSH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit Polyclonal antibody to interferon alpha Receptor 1 (interferon (alpha, beta and omega) receptor 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 3 and 240 of interferon alpha Receptor 1 (Uniprot ID#P17181) |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL |
Active filters
Isotypes
- IgG
Pathways
- Jak-STAT signaling pathway
Filter by
Category
Target Symbol
- AKT1 (51)
- STAT1 (24)
- STAT3 (21)
- JAK2 (19)
- STAT6 (17)
- BCL2L1 (16)
- PTPN11 (16)
- MYC (14)
- STAT5A (13)
- STAT5B (13)
- CCND1 (12)
- IL2 (11)
- IL4 (11)
- SOCS1 (11)
- EPOR (10)
- PIAS2 (10)
- LEP (9)
- STAT2 (9)
- JAK1 (8)
- STAT4 (8)
- AKT2 (7)
- CBL (7)
- CCND3 (7)
- IFNG (7)
- IL12A (7)
- IL7 (7)
- PIK3R1 (7)
- PTPN6 (7)
- TYK2 (7)
- CCND2 (6)
- CREBBP (6)
- EP300 (6)
- IFNB1 (6)
- IL10RA (6)
- IL11RA (6)
- IL22RA1 (6)
- IL23A (6)
- IL9 (6)
- PIAS1 (6)
- PIM1 (6)
- AKT3 (5)
- CNTF (5)
- CSF2 (5)
- CSF2RA (5)
- CSF3 (5)
- IL10 (5)
- IL15 (5)
- IL20 (5)
- IL21 (5)
- IL2RA (5)
- IL2RB (5)
- IL3 (5)
- IL6 (5)
- PIAS3 (5)
- PIK3CD (5)
- SOCS7 (5)
- CTF1 (4)
- EPO (4)
- GH2 (4)
- GHR (4)
- GRB2 (4)
- IFNAR1 (4)
- IL13 (4)
- IL13RA2 (4)
- IL15RA (4)
- IL3RA (4)
- IL5 (4)
- LIF (4)
- PIAS4 (4)
- PIK3CB (4)
- PIK3R3 (4)
- PRL (4)
- SOCS2 (4)
- SOCS3 (4)
- SOCS5 (4)
- TSLP (4)
- CNTFR (3)
- CRLF2 (3)
- CSH1 (3)
- IFNL3 (3)
- IL11 (3)
- IL12RB1 (3)
- IL12RB2 (3)
- IL13RA1 (3)
- IL19 (3)
- IL21R (3)
- IL22 (3)
- IL22RA2 (3)
- IL23R (3)
- IL24 (3)
- IL4R (3)
- IL6ST (3)
- JAK3 (3)
- OSM (3)
- PIK3CA (3)
- SOCS4 (3)
- SOS2 (3)
- SPRY2 (3)
- SPRY4 (3)
- CSF3R (2)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (692)
- Secreted Protein (211)
- ES Cell Differentiation/IPS (175)
- Transcription Factors (159)
- Transmembrane (155)
- Protein Kinase (106)
- Stem cell relevant signaling - JAK/STAT signaling pathway (93)
- Stem cell - Pluripotency (54)
- Stem cell relevant signaling - DSL/Notch pathway (45)
- Stem cell relevant signaling - Wnt Signaling pathway (26)
- Phosphatase (23)
- Embryonic stem cells (14)
- Induced pluripotent stem cells (14)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (14)
- Adult stem cells (4)