Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
IL7 rat monoclonal antibody, clone BVD10-40F6, Purified
| Applications | ELISA |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human IL-1 beta Purified (50 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
USD 380.00
In Stock
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (207)
- CD40 (125)
- KIT (93)
- TNFRSF8 (89)
- CD27 (76)
- TNFRSF9 (69)
- MET (64)
- PDGFRA (63)
- CSF3 (60)
- TNF (60)
- CSF2 (59)
- NGFR (55)
- KDR (53)
- VEGFA (53)
- PDGFRB (50)
- PRL (49)
- IL20 (46)
- IFNG (45)
- IL6 (42)
- TNFRSF18 (40)
- TNFRSF10B (39)
- EGF (38)
- IL1A (38)
- CSF2RB (37)
- IL2 (36)
- TNFRSF14 (36)
- TNFSF10 (35)
- TNFRSF4 (33)
- CD70 (32)
- HGF (31)
- IL10RA (31)
- KITLG (31)
- IL12A (30)
- IL24 (30)
- CSF1 (29)
- IL2RA (29)
- IL2RB (28)
- CCL2 (27)
- FLT4 (27)
- IFNLR1 (27)
- IL17A (27)
- CSF2RA (26)
- CXCL8 (26)
- IL17B (25)
- IL3RA (25)
- FLT1 (24)
- TNFRSF10A (24)
- VEGFB (24)
- VEGFD (24)
- CSF1R (23)
- CXCR4 (23)
- IL1B (23)
- IL20RA (23)
- IL4 (23)
- TGFB1 (22)
- IL12B (21)
- IL10 (20)
- IL15RA (20)
- TGFBR2 (20)
- ACVR2A (19)
- FAS (19)
- IL25 (19)
- TNFSF9 (19)
- EPOR (18)
- CCL19 (17)
- FLT3 (17)
- TNFSF11 (17)
- CCL5 (16)
- CXCL12 (16)
- IL15 (16)
- PDGFB (16)
- TNFSF4 (16)
- IL3 (15)
- TNFRSF10C (15)
- IL23R (14)
- IL6ST (14)
- IL7 (14)
- TNFRSF17 (14)
- CD40LG (13)
- FASLG (13)
- IL6R (13)
- LEP (13)
- TNFRSF11B (13)
- TNFRSF1A (13)
- GH1 (12)
- TNFRSF1B (12)
- TNFSF13B (12)
- CCL3 (11)
- CCR5 (11)
- CCR7 (11)
- EPO (11)
- IFNL1 (11)
- IL13 (11)
- PDGFA (11)
- TNFSF13 (11)
- TNFSF14 (11)
- CCL11 (10)
- CCL27 (10)
- CX3CR1 (10)
- FLT3LG (10)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (3694)
- Transmembrane (2589)
- Secreted Protein (2026)
- ES Cell Differentiation/IPS (1064)
- Protein Kinase (707)
- Adult stem cells (395)
- Cancer stem cells (223)
- Stem cell relevant signaling - JAK/STAT signaling pathway (215)
- Stem cell - Pluripotency (182)
- Embryonic stem cells (152)
- GPCR (123)
- Transcription Factors (97)
- Induced pluripotent stem cells (57)
- Protease (31)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (16)
- Stem cell relevant signaling - DSL/Notch pathway (8)