Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit Polyclonal Antibody against ALDH1A1 (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH1A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 302-331 amino acids from the Central region of human ALDH1A1. |
USD 415.00
In Stock
GLUD1 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal CYP17A1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP17A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-388 amino acids from the Central region of human CYP17A1. |
Rabbit Polyclonal Anti-GAPDH Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAPDH Antibody: A synthesized peptide derived from human GAPDH. |
Goat Polyclonal Anti-Catalase Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified catalase isolated from liver |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal ATP5J Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATP5J antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-56 amino acids from the Central region of human ATP5J. |
Rabbit polyclonal SPHK1 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
USD 380.00
4 Weeks
Mouse Monoclonal ATP-Citrate Lyase (C-terminus) Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
USD 85.00
4 Weeks
Mouse Monoclonal ATP-Citrate Lyase (C-terminus) Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
Rabbit Polyclonal Anti-HSD3B2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
Rabbit Polyclonal Anti-CYP21A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
Rabbit Polyclonal Antibody against MAT1/2 alpha
| Applications | WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Orang-Utan, Monkey (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human MAT2A protein (within residues 100-200). [Swiss-Prot# P31153] |
Rabbit polyclonal antibody to ODC (ornithine decarboxylase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 180 and 461 of ODC (Uniprot ID#P11926) |
Active filters
Reactivities
- Monkey
Pathways
- Metabolic pathways
Filter by
Category
Target Symbol
- ACAA2 (30)
- ACAT2 (25)
- ATP5F1B (25)
- SPR (25)
- AK4 (20)
- PGAM2 (20)
- AK1 (16)
- PFKP (15)
- SMS (15)
- CAT (11)
- FTCD (11)
- GAPDH (11)
- IDH1 (11)
- UQCRC1 (11)
- ALDH3A2 (10)
- ATIC (10)
- ATP6V1F (10)
- CTH (10)
- DLD (10)
- GLB1 (10)
- GPI (10)
- HIBCH (10)
- IVD (10)
- NDUFB10 (10)
- NDUFB9 (10)
- PPAT (10)
- PPT1 (10)
- RPN1 (10)
- NME1 (6)
- ODC1 (6)
- ACADS (5)
- ACY1 (5)
- ADH1B (5)
- ADSL (5)
- ALDH1A3 (5)
- ALOX15 (5)
- CBR3 (5)
- CHST6 (5)
- CMPK1 (5)
- CYP2A6 (5)
- CYP2B6 (5)
- DGKA (5)
- DGKB (5)
- DHFR (5)
- FDFT1 (5)
- GAD1 (5)
- GALE (5)
- GCLC (5)
- H6PD (5)
- HAO1 (5)
- HSD17B10 (5)
- IDS (5)
- LTA4H (5)
- PANK2 (5)
- PNMT (5)
- PNPO (5)
- POLR2E (5)
- POLR2J2 (5)
- PON1 (5)
- PYCR2 (5)
- SAT2 (5)
- ENPP3 (3)
- ATP CITRATE LYASE (2)
- ENO1 (2)
- MAT2A (2)
- PKM (2)
- PTGES (2)
- ALDH1A1 (1)
- ALDH2 (1)
- ALDOB (1)
- ATP5PF (1)
- CD38 (1)
- CERK (1)
- COMT (1)
- COX4I1 (1)
- COX7B2 (1)
- CYP11B1 (1)
- CYP17A1 (1)
- CYP19A1 (1)
- CYP21A2 (1)
- FPGT (1)
- GANAB (1)
- GCLM (1)
- GCNT3 (1)
- GK2 (1)
- GLUD1 (1)
- GOT1 (1)
- GOT2 (1)
- HSD3B1 (1)
- HSD3B2 (1)
- MAOB (1)
- NAT1 (1)
- NAT2 (1)
- PCK1 (1)
- PGAM1 (1)
- PIB5PA (1)
- PLA2G3 (1)
- SPHK1 (1)
- TYMS (1)