Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
USD 515.00
In Stock
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified
| Applications | ELISA, FC, IP |
| Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit. |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human KIT. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
USD 250.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Purified
| Applications | FC, IHC |
| Reactivities | Human |
IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 300.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-B10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
USD 280.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-G3, Azide Free
| Applications | FC |
| Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Purified
| Applications | FC |
| Reactivities | Human |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit. |
c Kit (KIT) pTyr721 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal KIT/CD117 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1 |
Rabbit anti CD25 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full length (1-272 aa) of human CD25. |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti CD117/Kit (NT)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human Kit protein. This sequence is identical among human and dog origins. |
Rabbit anti CD117/Kit (IN)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from extracellular domain of Kit protein. This sequence is identical in human and dog origins. |
KIT Capture mouse monoclonal antibody, Luminex validated, clone OTI1E2
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI2C1H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KIT mouse monoclonal antibody, clone OTI6F8 (formerly 6F8)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
