Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
ANAPC2 (untagged)-Human anaphase promoting complex subunit 2 (ANAPC2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ANAPC5 (untagged)-Human anaphase promoting complex subunit 5 (ANAPC5), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human anaphase promoting complex subunit 5 (ANAPC5), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human anaphase promoting complex subunit 5 (ANAPC5), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human anaphase promoting complex subunit 2 (ANAPC2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
ANAPC11 (untagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ANAPC10 (untagged)-Human anaphase promoting complex subunit 10 (ANAPC10)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-ANAPC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ANAPC5. |
Purified recombinant protein of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
ANAPC2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of anaphase promoting complex subunit 2 (ANAPC2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of anaphase promoting complex subunit 5 (ANAPC5), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC11 (untagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ANAPC11 (untagged)-Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ANAPC2 (untagged)-Human anaphase promoting complex subunit 2 (ANAPC2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Anti-ANAPC11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PALDQETSSLLRCTS, from the Internal region of the protein sequence according to NP_001002244.1; NP_057560.8. |
Apc5 (ANAPC5) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human ANAPC5 |
Rabbit Polyclonal Anti-ANAPC10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL |
Mouse monoclonal Anti-APC11 Clone AX2.1
| Reactivities | Frog, Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-APC5 Clone APC5#4
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Germany
Japan
United Kingdom
China
