Germany
Japan
United Kingdom
China
Research Areas
CD8A rat monoclonal antibody, clone YTC182.20, Purified
| Applications | FC, IHC |
| Reactivities | Human, Monkey |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MEM-55, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Primate |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
USD 440.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
IL6R mouse monoclonal antibody, clone B-R6, Azide Free
| Applications | FC, FN, IHC, IP |
| Reactivities | Human |
CD41 (ITGA2B) (alpha) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from N-terminal domain of CD41 |
HLA Class I ABC mouse monoclonal antibody, clone W6/32, HRP
| Applications | IHC |
| Reactivities | Bovine, Feline, Human, Monkey, Primate |
| Conjugation | HRP |
USD 745.00
5 Days
Tumor necrosis factor (TNF-alpha) rat monoclonal antibody, clone MP6-XT22, Low Endotoxin
| Applications | ELISA, FC, FN, IHC |
| Reactivities | Mouse, Rat |
Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified
| Applications | ELISA, FC, IF, IHC, WB |
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone MEM-181, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
NCAM1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NCAM1 |
TA371291 is a possible alternative to TA351057.
Il6ra mouse monoclonal antibody, clone B-F19, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
IL6 mouse monoclonal antibody, clone B-E8, Azide Free
| Applications | ELISA, FC, FN |
| Reactivities | Human |
CD20 (MS4A1) mouse monoclonal antibody, clone NKI-B20/1, Purified
| Applications | ELISA, FC, IHC, IP |
| Reactivities | Human |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Filter by
Target Symbol
- CD4 (130)
- PECAM1 (121)
- PTPRC (97)
- CD19 (90)
- KIT (89)
- CD99 (87)
- PDCD1 (87)
- LGALS3 (82)
- CD68 (74)
- MS4A1 (70)
- CD5 (69)
- CD34 (68)
- NCAM1 (65)
- MAPK8 (64)
- ESR1 (62)
- TNFRSF8 (57)
- IL6 (51)
- CR2 (49)
- CD274 (48)
- MME (47)
- WNT3 (47)
- IL1RN (44)
- DVL2 (42)
- CD2 (41)
- CD8A (41)
- CD22 (39)
- CRP (38)
- FCER2 (38)
- IL2RA (38)
- TNF (37)
- TYRO3 (37)
- CD14 (36)
- ANAPC11 (34)
- CD33 (34)
- ROR2 (34)
- ANAPC2 (33)
- IL3RA (31)
- MAPK9 (31)
- CD79B (29)
- RORA (28)
- CD3E (26)
- CSF3 (25)
- ANPEP (22)
- ITGB3 (21)
- PTK7 (20)
- FCGR1A (19)
- IL6ST (19)
- MAPK10 (19)
- CD74 (17)
- ROCK2 (17)
- IL2 (16)
- IL6R (16)
- POSTN (16)
- LEF1 (15)
- ROR1 (15)
- IL12B (14)
- CD79A (13)
- TLR8 (13)
- WNT1 (13)
- CD7 (12)
- CEBPB (12)
- ESR2 (12)
- IL36G (12)
- ITGA2B (12)
- TLR2 (12)
- TLR4 (12)
- CASP1 (11)
- FZD4 (11)
- IL1B (11)
- ANAPC5 (10)
- CEBPD (10)
- IL1A (10)
- ROCK1 (10)
- TLR3 (10)
- WNT2B (10)
- WNT3A (10)
- WNT5B (10)
- AGTPBP1 (9)
- FCGR3A (9)
- LRP6 (9)
- CD1A (8)
- FZD2 (8)
- IL10 (8)
- ITGAX (8)
- TCF25 (8)
- WNT10A (8)
- CALR (7)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- HLA-A (7)
- HLA-DRB5 (7)
- IL18 (7)
- IL36A (7)
- LRP5 (7)
- TCF4 (7)
- TCF7L2 (7)
- TLR5 (7)
- TLR6 (7)
- WNT16 (7)
Reactivities
- Human (3054)
- Mouse (1128)
- Rat (880)
- Monkey (108)
- Dog (92)
- Bovine (27)
- Rabbit (17)
- Canine (16)
- Chicken (13)
- Hamster (12)
- Porcine (12)
- Gorilla (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (8)
- Canis (5)
- Chimpanzee (5)
- Primate (5)
- Cow (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Equine (1)
- Frog (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Rhesus Monkey (1)
- Sheep (1)
- Squirrel (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (30)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (6)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric human antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- This is a reformatted human IgG1 antibody based on the therapeutic Fab fragment. NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (2508)
- Transmembrane (1965)
- ES Cell Differentiation/IPS (956)
- Secreted Protein (572)
- Adult stem cells (374)
- Protein Kinase (329)
- Embryonic stem cells (178)
- Transcription Factors (163)
- Stem cell - Pluripotency (135)
- Induced pluripotent stem cells (125)
- Cancer stem cells (95)
- Nuclear Hormone Receptor (94)
- Phosphatase (94)
- Protease (84)
- GPCR (44)
- Stem cell relevant signaling - Wnt Signaling pathway (36)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
Pathways
- Hematopoietic cell lineage (1030)
- Cell adhesion molecules (CAMs) (789)
- Pathways in cancer (479)
- T cell receptor signaling pathway (431)
- Wnt signaling pathway (376)
- Cytokine-cytokine receptor interaction (368)
- Primary immunodeficiency (356)
- Melanogenesis (321)
- Toll-like receptor signaling pathway (285)
- Basal cell carcinoma (238)
- Leukocyte transendothelial migration (225)
- Colorectal cancer (221)
- B cell receptor signaling pathway (210)
- MAPK signaling pathway (197)
- Antigen processing and presentation (189)
- NOD-like receptor signaling pathway (185)
- Progesterone-mediated oocyte maturation (185)
- Jak-STAT signaling pathway (175)
- Focal adhesion (152)
- RIG-I-like receptor signaling pathway (144)
- Fc epsilon RI signaling pathway (138)
- Adipocytokine signaling pathway (131)
- Type II diabetes mellitus (127)
- Hedgehog signaling pathway (125)
- Endocytosis (122)
- Fc gamma R-mediated phagocytosis (119)
- ErbB signaling pathway (116)
- Neurotrophin signaling pathway (115)
- Epithelial cell signaling in Helicobacter pylori infection (114)
- Prion diseases (113)
- GnRH signaling pathway (111)
- Insulin signaling pathway (109)
- Graft-versus-host disease (107)
- Pancreatic cancer (107)
- Acute myeloid leukemia (105)
- Regulation of actin cytoskeleton (93)
- Hypertrophic cardiomyopathy (HCM) (80)
- Type I diabetes mellitus (80)
- Oocyte meiosis (79)
- Cell cycle (78)
- Ubiquitin mediated proteolysis (78)
- Allograft rejection (73)
- Alzheimer's disease (72)
- Apoptosis (71)
- Lysosome (70)
- Pathogenic Escherichia coli infection (67)
- Renin-angiotensin system (65)
- Systemic lupus erythematosus (62)
- Cytosolic DNA-sensing pathway (56)
- Complement and coagulation cascades (52)
- Asthma (44)
- Natural killer cell mediated cytotoxicity (44)
- Dilated cardiomyopathy (43)
- Notch signaling pathway (43)
- TGF-beta signaling pathway (43)
- Autoimmune thyroid disease (41)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (36)
- Amyotrophic lateral sclerosis (ALS) (35)
- Chemokine signaling pathway (34)
- Axon guidance (25)
- Vascular smooth muscle contraction (25)
- Endometrial cancer (23)
- Metabolic pathways (23)
- Viral myocarditis (23)
- Glutathione metabolism (21)
- ECM-receptor interaction (20)
- Prostate cancer (20)
- Adherens junction (19)
- Thyroid cancer (17)
- Bladder cancer (8)
- Renal cell carcinoma (8)
- VEGF signaling pathway (7)
- Chronic myeloid leukemia (6)
- Glioma (6)
- Small cell lung cancer (6)
- Non-small cell lung cancer (5)
- Long-term depression (4)
- Long-term potentiation (4)
- Melanoma (4)
- mTOR signaling pathway (4)
- Gap junction (3)
- PPAR signaling pathway (3)
- Tight junction (3)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Arginine and proline metabolism (1)
- Dorso-ventral axis formation (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Inositol phosphate metabolism (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Vibrio cholerae infection (1)