Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
Rabbit Polyclonal Anti-PUF60 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit Polyclonal Anti-PCBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-SF3B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the N terminal of human SF3B1. Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR |
Rabbit Polyclonal Anti-HNRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1. Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
Rabbit Polyclonal Anti-RBM8A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM8A antibody: synthetic peptide directed towards the N terminal of human RBM8A. Synthetic peptide located within the following region: LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDS |
Rabbit Polyclonal Anti-PUF60 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
Rabbit Polyclonal Anti-RBM22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF |
Rabbit Polyclonal Anti-LSM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
Rabbit Polyclonal Anti-THOC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT |
Rabbit Polyclonal Anti-FUSIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS |
Rabbit Polyclonal Anti-HNRPA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS |
Rabbit Polyclonal Anti-HNRPA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3. Synthetic peptide located within the following region: PGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE |
Rabbit Polyclonal Anti-SF3B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3B1 antibody: synthetic peptide directed towards the middle region of human SF3B1. Synthetic peptide located within the following region: LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG |
Rabbit Polyclonal Anti-HNRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the C terminal of human HNRPA1. Synthetic peptide located within the following region: NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG |
Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10. Synthetic peptide located within the following region: MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKS |
Rabbit Polyclonal Anti-SFRS10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD |
Rabbit Polyclonal Anti-SNRPA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV |
Rabbit Polyclonal Anti-CDC5L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE |
Rabbit Polyclonal Anti-SNRPD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL |
Rabbit Polyclonal Anti-LSM4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK |
Rabbit Polyclonal Anti-PUF60 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ |
Rabbit Polyclonal Anti-SFRS2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS2B antibody: synthetic peptide directed towards the middle region of human SFRS2B. Synthetic peptide located within the following region: YRESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSA |
Rabbit Polyclonal Anti-SNRP70 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the N terminal of human SNRP70. Synthetic peptide located within the following region: YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK |
USD 410.00
5 Days
Rabbit Polyclonal Anti-RP11-78J21.1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
USD 475.00
5 Days
Rabbit Polyclonal Anti-RP11-78J21.1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN |
Rabbit Polyclonal Anti-HNRPK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the C terminal of human HNRPK. Synthetic peptide located within the following region: YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS |
Rabbit Polyclonal Anti-HNRPK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPK antibody: synthetic peptide directed towards the N terminal of human HNRPK. Synthetic peptide located within the following region: NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG |
Rabbit Polyclonal Anti-SNRP70 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRP70 antibody: synthetic peptide directed towards the C terminal of human SNRP70. Synthetic peptide located within the following region: RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR |
Rabbit Polyclonal Anti-SNRPF Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF. Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY |
Rabbit Polyclonal Anti-SF3B4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE |
Rabbit Polyclonal Anti-SMNDC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the middle region of human SMNDC1. Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK |
Rabbit Polyclonal Anti-PPIE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIE antibody: synthetic peptide directed towards the middle region of human PPIE. Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP |
U2AF1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human U2AF1 |
Rabbit anti-SFRS1 Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SFRS1 |
Rabbit anti-SNRPE Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SNRPE |
Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290) |
Active filters
Applications
- IHC
Pathways
- Spliceosome
Filter by
Category
Target Symbol
- HSPA1A (38)
- HNRNPM (28)
- DDX39B (26)
- SF3A1 (20)
- SRSF9 (15)
- PCBP1 (11)
- HSPA8 (10)
- SLU7 (10)
- SNRPB2 (10)
- HNRNPC (6)
- PPIL1 (6)
- THOC3 (6)
- SF3B6 (5)
- SYF2 (5)
- HNRNPA1 (4)
- PUF60 (4)
- ALYREF (3)
- BCAS2 (3)
- HNRNPK (3)
- ACIN1 (2)
- CDC5L (2)
- CTNNBL1 (2)
- HNRNPA1L2 (2)
- HNRNPA3 (2)
- PRPF19 (2)
- RBM8A (2)
- RBMX (2)
- SF3B1 (2)
- SF3B4 (2)
- SNRNP70 (2)
- SNRPA (2)
- SRSF1 (2)
- TRA2A (2)
- TRA2B (2)
- DDX5 (1)
- EFTUD2 (1)
- HSPA6 (1)
- LSM2 (1)
- LSM4 (1)
- PPIE (1)
- PQBP1 (1)
- PRPF3 (1)
- PRPF31 (1)
- PRPF38A (1)
- RBM22 (1)
- SART1 (1)
- SF3B3 (1)
- SMNDC1 (1)
- SNRNP27 (1)
- SNRPD1 (1)
- SNRPD3 (1)
- SNRPE (1)
- SNRPF (1)
- SNU13 (1)
- SNW1 (1)
- SRSF10 (1)
- SRSF3 (1)
- SRSF7 (1)
- SRSF8 (1)
- THOC1 (1)
- U2AF1 (1)
- WBP11 (1)