Germany
Japan
United Kingdom
China
Products
Download
USD 390.00
In Stock
MHC Class I Heavy Chain (Restricted expression) mouse monoclonal antibody, clone HC10, Purified
| Applications | ELISA, EM, FC, IF, IHC, IP, WB |
| Reactivities | Human |
H2-D1 mouse monoclonal antibody, clone 28-14-8, Purified
| Applications | CT, FC, FN, IHC, IP |
| Reactivities | Mouse |
USD 250.00
2 Weeks
USD 415.00
2 Weeks
Adeno-associated Virus / AAV (VP1 + VP2 + VP3) mouse monoclonal antibody, clone B1, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
USD 475.00
2 Weeks
USD 415.00
2 Weeks
Adeno-Associated Virus 2 / AAV2 (intact particle) mouse monoclonal antibody, clone A20, Purified
| Applications | ELISA, FN, IF, IHC, IP |
| Reactivities | Human, Monkey |
Cd28 hamster monoclonal antibody, clone 37.51, Purified
| Applications | FC, FN, IP |
| Reactivities | Mouse |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Pdpn hamster monoclonal antibody, clone 811, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
HLA Class II DR mouse monoclonal antibody, clone L243, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Canine, Human, Primate |
USD 220.00
2 Weeks
p75 NGF Receptor (NGFR) (1-160) mouse monoclonal antibody, clone NGFR5, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Feline, Ferret, Human, Monkey, Rabbit |
CD4 mouse monoclonal antibody, clone MEM-115, Azide Free
| Applications | FC, FN, IP, WB |
| Reactivities | Human |
USD 420.00
In Stock
Cd80 hamster monoclonal antibody, clone 16-10A1, Aff - Purified
| Applications | FC, FN, IHC, IP |
| Reactivities | Canine, Mouse |
USD 390.00
2 Weeks
MHC Class I Heavy Chain (Restricted expression) mouse monoclonal antibody, clone HCA2, Purified
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human |
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Birds, Mammalian, Yeast |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CD3E mouse monoclonal antibody, clone MEM-92, Purified
| Applications | FC, FN, IP |
| Reactivities | Human |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
CD82 mouse monoclonal antibody, clone C33, Aff - Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human |
Aggrecan (ACAN) mouse monoclonal antibody, clone HAG7D4 (7D4), Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
MITF mouse monoclonal antibody, clone C5, Purified
| Applications | EMSA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
USD 395.00
2 Weeks
Adeno-Associated Virus 5 / AAV5 (intact particle) mouse monoclonal antibody, clone ADK5a, Aff - Purified
| Applications | ELISA, IF, IHC, IP, NEUT |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Tenascin C (TNC) mouse monoclonal antibody, clone T2H5, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
OVAL rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Chicken |
| Conjugation | Biotin |
| Immunogen | Native Ovalbumin from hen egg white |
USD 220.00
2 Weeks
GM CSF Receptor alpha (CSF2RA) mouse monoclonal antibody, clone 4H1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IP
Filter by
Target Symbol
- LIPG (105)
- BRAF (71)
- MAPK1 (56)
- FCGR2A (47)
- CRYAB (46)
- NEUROG1 (45)
- NRBP1 (45)
- RALBP1 (45)
- LTA4H (40)
- L1CAM (37)
- RPA2 (37)
- GBE1 (35)
- TYRO3 (35)
- PIM2 (31)
- SSB (31)
- PLK1 (30)
- SLC2A5 (30)
- CHEK2 (28)
- LDHA (28)
- SERPINA1 (26)
- DAPK2 (25)
- ALB (21)
- MAP2K4 (21)
- C3 (20)
- FERMT2 (20)
- LEMD3 (20)
- H3-4 (18)
- CAS9 (17)
- EGFR (16)
- GAD1 (16)
- LTF (16)
- USP13 (16)
- HDAC10 (15)
- NEK6 (15)
- TP53 (14)
- AKT2 (11)
- CD3E (11)
- CD74 (11)
- AKT1 (10)
- BAX (10)
- DDK (10)
- SLC7A8 (10)
- TUBA8 (10)
- MDH1 (9)
- MYC (9)
- NEUROG3 (9)
- CD8A (8)
- CTNNB1 (8)
- HIST1H3A (8)
- MAPK8 (8)
- C2 (7)
- CCR5 (7)
- CD40 (7)
- RELA (7)
- CA1 (6)
- CDK1 (6)
- CREB1 (6)
- GALM (6)
- GSK3B (6)
- HISTONE H3 (6)
- LDHB (6)
- NFKBIA (6)
- NIPBL (6)
- RNASE1 (6)
- S PROTEIN (6)
- SHC1 (6)
- SQSTM1 (6)
- STAT1 (6)
- CD44 (5)
- CD86 (5)
- CDKN1A (5)
- CP (5)
- CYCS (5)
- EIF4E (5)
- EIF4EBP1 (5)
- GADD45G (5)
- H3C1 (5)
- IL2RA (5)
- INSR (5)
- JUN (5)
- MUC1 (5)
- PLG (5)
- PROM2 (5)
- SELL (5)
- SORD (5)
- STAT3 (5)
- TF (5)
- TUBA1B (5)
- XRCC5 (5)
- ACTA1 (4)
- ADRB2 (4)
- AOC3 (4)
- BCL2 (4)
- CASP3 (4)
- CAT (4)
- CCND1 (4)
- CCRL2 (4)
- CD22 (4)
- CD27 (4)
- CDK2 (4)
Reactivities
- Human (2775)
- Mouse (2070)
- Rat (1852)
- Monkey (298)
- Dog (233)
- Bovine (29)
- Hamster (24)
- Other (Wide Range) (22)
- Zebrafish (17)
- Rabbit (13)
- Sheep (12)
- Xenopus (12)
- Chicken (11)
- C-term DDK (10)
- Streptococcus Pyogenes (10)
- Pig (9)
- Goat (7)
- SARS-CoV-2 (7)
- Canine (6)
- Chimpanzee (6)
- Porcine (6)
- Cow (5)
- Primate (5)
- Rhesus Monkey (5)
- Cynomolgus (4)
- X. tropicalis (4)
- Ferret (3)
- Saccharomyces cerevisiae (3)
- Baboon (2)
- Broad (2)
- Feline (2)
- Fusion proteins containing the Flag Tag (2)
- Guinea Pig (2)
- Macaque (2)
- Marmoset (2)
- C. elegans (1)
- Drosophila melanogaster (1)
- Fish (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (347)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (27)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (10)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho S15 (2)
- Phospho S727 (2)
- Phospho S9 (2)
- Phospho-specific (2)
- This chimeric hamster (Armenian) antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K27 (1)
- Acetyl K5 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- MonoMethyl K36 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S157 (1)
- Phospho S2 (1)
- Phospho S21 (1)
- Phospho S22 (1)
- Phospho S240/244 (1)
- Phospho S259 (1)
- Phospho S298 (1)
- Phospho S33 (1)
- Phospho S380 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S473 (1)
- Phospho S51 (1)
- Phospho S621 (1)
- Phospho S65 (1)
- Phospho S82 (1)
- Phospho S957 (1)
- Phospho T183/T172 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T359 (1)
- Phospho T669 (1)
- Phospho Y1068 (1)
- Phospho Y15 (1)
- Phospho Y416/Y416 (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted antibody was made using the variable domain sequences of the original mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- TriMethyl K56 (1)
- pan-Mono-Methyl K (1)
- pan-tri-Methyl K (1)
Assay Types
Families
- Druggable Genome (1214)
- Protein Kinase (401)
- Transmembrane (282)
- ES Cell Differentiation/IPS (236)
- Secreted Protein (232)
- Transcription Factors (189)
- Stem cell - Pluripotency (141)
- Protease (105)
- Adult stem cells (21)
- Embryonic stem cells (14)
- Stem cell relevant signaling - JAK/STAT signaling pathway (14)
- Cancer stem cells (10)
- Phosphatase (10)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (9)
- Induced pluripotent stem cells (8)
- Stem cell relevant signaling - Wnt Signaling pathway (8)
- Nuclear Hormone Receptor (7)
- GPCR (6)
- Stem cell relevant signaling - DSL/Notch pathway (4)
- Ion Channels: Other (2)
- Ion Channels: Potassium (2)
- Ion Channels: Transient receptor potential (2)
- Ion Channels: Calcium (1)
Pathways
- Pathways in cancer (275)
- Metabolic pathways (261)
- Pancreatic cancer (200)
- MAPK signaling pathway (198)
- Acute myeloid leukemia (182)
- ErbB signaling pathway (181)
- Focal adhesion (178)
- Progesterone-mediated oocyte maturation (178)
- Colorectal cancer (167)
- Neurotrophin signaling pathway (166)
- Bladder cancer (164)
- Chronic myeloid leukemia (163)
- Prostate cancer (160)
- Insulin signaling pathway (156)
- Endometrial cancer (154)
- Glioma (153)
- Chemokine signaling pathway (148)
- Melanoma (146)
- Natural killer cell mediated cytotoxicity (146)
- Non-small cell lung cancer (146)
- Regulation of actin cytoskeleton (144)
- mTOR signaling pathway (144)
- Renal cell carcinoma (141)
- Thyroid cancer (136)
- Systemic lupus erythematosus (133)
- Long-term potentiation (126)
- Vascular smooth muscle contraction (126)
- Long-term depression (124)
- Fc gamma R-mediated phagocytosis (117)
- Glycerolipid metabolism (105)
- Toll-like receptor signaling pathway (102)
- Cell cycle (97)
- Fc epsilon RI signaling pathway (93)
- Axon guidance (92)
- Oocyte meiosis (92)
- T cell receptor signaling pathway (91)
- GnRH signaling pathway (84)
- Gap junction (81)
- B cell receptor signaling pathway (72)
- Adherens junction (70)
- TGF-beta signaling pathway (68)
- VEGF signaling pathway (68)
- Complement and coagulation cascades (67)
- NOD-like receptor signaling pathway (66)
- Prion diseases (66)
- Cell adhesion molecules (CAMs) (61)
- Type II diabetes mellitus (59)
- Alzheimer's disease (58)
- Melanogenesis (58)
- Dorso-ventral axis formation (56)
- Nucleotide excision repair (46)
- DNA replication (45)
- Arachidonic acid metabolism (42)
- p53 signaling pathway (42)
- Small cell lung cancer (40)
- Homologous recombination (39)
- Mismatch repair (39)
- Starch and sucrose metabolism (36)
- Epithelial cell signaling in Helicobacter pylori infection (35)
- Apoptosis (33)
- Glycolysis / Gluconeogenesis (32)
- Pathogenic Escherichia coli infection (32)
- Pyruvate metabolism (32)
- Jak-STAT signaling pathway (30)
- Tight junction (29)
- Adipocytokine signaling pathway (27)
- Cytokine-cytokine receptor interaction (25)
- Huntington's disease (24)
- Wnt signaling pathway (24)
- Cysteine and methionine metabolism (23)
- Propanoate metabolism (23)
- Antigen processing and presentation (21)
- Hematopoietic cell lineage (21)
- Type I diabetes mellitus (21)
- Endocytosis (19)
- Leukocyte transendothelial migration (19)
- Butanoate metabolism (18)
- ECM-receptor interaction (18)
- Alanine (16)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (16)
- Hypertrophic cardiomyopathy (HCM) (16)
- Taurine and hypotaurine metabolism (16)
- Viral myocarditis (16)
- aspartate and glutamate metabolism (16)
- beta-Alanine metabolism (16)
- Primary immunodeficiency (15)
- Amyotrophic lateral sclerosis (ALS) (14)
- Dilated cardiomyopathy (14)
- RIG-I-like receptor signaling pathway (14)
- Non-homologous end-joining (10)
- Citrate cycle (TCA cycle) (9)
- Maturity onset diabetes of the young (9)
- Neuroactive ligand-receptor interaction (9)
- Vibrio cholerae infection (9)
- Calcium signaling pathway (8)
- RNA degradation (8)
- Porphyrin and chlorophyll metabolism (7)
- Purine metabolism (7)
- Spliceosome (7)
- Basal cell carcinoma (6)
- Fructose and mannose metabolism (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Notch signaling pathway (6)
- Pyrimidine metabolism (6)
- Ubiquitin mediated proteolysis (6)
- Cytosolic DNA-sensing pathway (5)
- Graft-versus-host disease (5)
- Nitrogen metabolism (5)
- PPAR signaling pathway (5)
- Parkinson's disease (5)
- Proteasome (5)
- Allograft rejection (4)
- Autoimmune thyroid disease (4)
- Cardiac muscle contraction (4)
- Glycine (4)
- Selenoamino acid metabolism (4)
- serine and threonine metabolism (4)
- Fatty acid metabolism (3)
- Lysine degradation (3)
- Lysosome (3)
- Oxidative phosphorylation (3)
- RNA polymerase (3)
- Valine (3)
- Arginine and proline metabolism (2)
- Biosynthesis of unsaturated fatty acids (2)
- Cyanoamino acid metabolism (2)
- Fatty acid elongation in mitochondria (2)
- Glutathione metabolism (2)
- Histidine metabolism (2)
- Methane metabolism (2)
- Riboflavin metabolism (2)
- Taste transduction (2)
- Tryptophan metabolism (2)
- leucine and isoleucine degradation (2)
- ABC transporters (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Asthma (1)
- Basal transcription factors (1)
- Base excision repair (1)
- Fatty acid biosynthesis (1)
- Folate biosynthesis (1)
- Galactose metabolism (1)
- Hedgehog signaling pathway (1)
- Limonene and pinene degradation (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- One carbon pool by folate (1)
- Phenylalanine metabolism (1)
- Regulation of autophagy (1)
- SNARE interactions in vesicular transport (1)
- Tyrosine metabolism (1)
- leucine and isoleucine biosynthesis (1)