Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Insig1 antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 248 of rat Insig1 |
Products
View as table Download
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal PRDX2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2. |
Rabbit polyclonal HMGA1 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Mouse Monoclonal hHR23b Antibody
| Applications | IF, IHC, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HSPA1A (Y41)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B. |
Rabbit Polyclonal Antibody against FAU (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-59 amino acids from the C-terminal region of human FAU. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit polyclonal anti-Calcineurin A antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
| Applications | WB |
| Reactivities | Hamster, Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Rabbit polyclonal PPAR alpha antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat, Bovine, Dog, Golden Hamster, Boar |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1 to 18 of mouse PPAR alpha. |
Rabbit polyclonal SORBS1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1. |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rat Monoclonal Anti-TCP1 alpha Antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Rabbit, Guinea pig, Hamster, Cow, Dog, Human, Pig, Saccharomyces cerevisiae, Caenorhabditis elegans, Fruit fly (Drosophila melanogaster), Monkey |
| Conjugation | Unconjugated |
Rabbit Polyclonal LIMPII/SR-B2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114] |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Mouse Monoclonal FEN-1 Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
HSP70-1A (HSPA1A) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Monkey, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 559 of human Hsp70 |
Mouse Anti-Synaptobrevin (VAMP) Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Syntaxin Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Mouse Monoclonal anti-PDIA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Dog, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Cyclin B1 phospho S126 antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Chimpanzee, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 120-131 of Human Cyclin B1 protein. |
Mouse monoclonal anti-PMS2 antibody
| Applications | WB |
| Reactivities | Chimpanzee, Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal TAF7 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAF7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-337 amino acids from the C-terminal region of human TAF7. |
Mouse monoclonal SUMO2 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Mouse CCNB1 Antibody (Center S123/S125)
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Mouse monoclonal Erp57 (Grp58) Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Hamster
Applications
- WB
Filter by
Category
Target Symbol
- CANX (6)
- HSPD1 (6)
- HSPA1A (5)
- HSPA8 (4)
- ACTB (3)
- TUBB (3)
- VIM (3)
- BECLIN 1 (2)
- CALR (2)
- CCNB1 (2)
- HIF1A (2)
- HP1 GAMMA (2)
- HSP90B1 (2)
- HSPA5 (2)
- KCNQ1 (2)
- MAP2K1 (2)
- MAPK14 (2)
- PCNA (2)
- PDIA3 (2)
- SCARB1 (2)
- SMAD3 (2)
- SNAP25 (2)
- SREBF1 (2)
- STIP1 (2)
- SYNTAXIN (2)
- TCP1 (2)
- ABCA1 (1)
- ABCG1 (1)
- ACTA1 (1)
- AGR2 (1)
- AKT1 (1)
- AKT2 (1)
- ALDH2 (1)
- ATIC (1)
- BCL2L1 (1)
- CD8A (1)
- CDK2 (1)
- COPE (1)
- COX4I1 (1)
- CTNNB1 (1)
- DDIT3 (1)
- DNM1L (1)
- FASN (1)
- FAU (1)
- FEN1 (1)
- FKBP4 (1)
- FKBP5 (1)
- FTH1 (1)
- GAPDH (1)
- GSK3B (1)
- HK2 (1)
- HMGA1 (1)
- HMGB1 (1)
- HSF2 (1)
- HSPH1 (1)
- INSIG1 (1)
- KCNQ2 (1)
- KCNQ3 (1)
- KCNQ4 (1)
- KDELR1 (1)
- KDM1A (1)
- KDR (1)
- KIF11 (1)
- KRT10 (1)
- LAMP1 (1)
- LPP (1)
- MAPK8 (1)
- MMP12 (1)
- MSN (1)
- NDUFS6 (1)
- NKX2-1 (1)
- NPC1 (1)
- OPA1 (1)
- PCYT1A (1)
- PDCD6IP (1)
- PIK3R1 (1)
- PMS2 (1)
- PPARA (1)
- PPP3CB (1)
- PRDX2 (1)
- PRION (1)
- RAD21 (1)
- RAD23B (1)
- RAD50 (1)
- RBBP4 (1)
- RPS20 (1)
- SAT1 (1)
- SCARB2 (1)
- SCD (1)
- SF3B1 (1)
- SMAD2 (1)
- SOD1 (1)
- SOD2 (1)
- SORBS1 (1)
- SPP1 (1)
- SRC (1)
- STAT3 (1)
- STX1A (1)
- SUMO2 (1)
- TAF7 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho-specific (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
Pathways
- Antigen processing and presentation (20)
- MAPK signaling pathway (15)
- Prion diseases (12)
- Pathways in cancer (11)
- Endocytosis (10)
- Focal adhesion (8)
- Spliceosome (8)
- Insulin signaling pathway (7)
- Metabolic pathways (7)
- Pancreatic cancer (7)
- VEGF signaling pathway (7)
- Pathogenic Escherichia coli infection (6)
- Prostate cancer (6)
- RNA degradation (6)
- Renal cell carcinoma (6)
- Type I diabetes mellitus (6)
- Vibrio cholerae infection (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Chronic myeloid leukemia (5)
- Gap junction (5)
- Neurotrophin signaling pathway (5)
- Progesterone-mediated oocyte maturation (5)
- Regulation of actin cytoskeleton (5)
- T cell receptor signaling pathway (5)
- Acute myeloid leukemia (4)
- Adherens junction (4)
- Apoptosis (4)
- B cell receptor signaling pathway (4)
- Base excision repair (4)
- Bladder cancer (4)
- Cell cycle (4)
- Chemokine signaling pathway (4)
- Colorectal cancer (4)
- Endometrial cancer (4)
- Fc epsilon RI signaling pathway (4)
- Fc gamma R-mediated phagocytosis (4)
- Glioma (4)
- Leukocyte transendothelial migration (4)
- Melanoma (4)
- Non-small cell lung cancer (4)
- Oocyte meiosis (4)
- Tight junction (4)
- Toll-like receptor signaling pathway (4)
- mTOR signaling pathway (4)
- Alzheimer's disease (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- DNA replication (3)
- Dilated cardiomyopathy (3)
- ErbB signaling pathway (3)
- GnRH signaling pathway (3)
- Huntington's disease (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Jak-STAT signaling pathway (3)
- Long-term potentiation (3)
- Mismatch repair (3)
- NOD-like receptor signaling pathway (3)
- Natural killer cell mediated cytotoxicity (3)
- Non-homologous end-joining (3)
- Nucleotide excision repair (3)
- Small cell lung cancer (3)
- Thyroid cancer (3)
- Viral myocarditis (3)
- ABC transporters (2)
- Adipocytokine signaling pathway (2)
- Arginine and proline metabolism (2)
- Cytokine-cytokine receptor interaction (2)
- Dorso-ventral axis formation (2)
- Glycolysis / Gluconeogenesis (2)
- Long-term depression (2)
- Lysosome (2)
- Melanogenesis (2)
- PPAR signaling pathway (2)
- Parkinson's disease (2)
- Regulation of autophagy (2)
- SNARE interactions in vesicular transport (2)
- Vascular smooth muscle contraction (2)
- Wnt signaling pathway (2)
- p53 signaling pathway (2)
- Ascorbate and aldarate metabolism (1)
- Axon guidance (1)
- Basal cell carcinoma (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Butanoate metabolism (1)
- Calcium signaling pathway (1)
- Cardiac muscle contraction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fatty acid biosynthesis (1)
- Fatty acid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Histidine metabolism (1)
- Homologous recombination (1)
- Limonene and pinene degradation (1)
- Lysine degradation (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Propanoate metabolism (1)
- Purine metabolism (1)
- Pyruvate metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Ribosome (1)
- Tryptophan metabolism (1)
- Valine (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine degradation (1)