Products

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12)

Goat Polyclonal Antibody against FOXC1

Applications FC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen Peptide with sequence RTSGAFVYDCSKF, from the C Terminus of the protein sequence according to NP_001444.1.

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit Polyclonal Antibody against ATG5

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390)

Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924)

Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0)

Rabbit Polyclonal antibody to VCP (valosin-containing protein)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072)

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492)

TPM1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Recombinant protein of human TPM1

Rabbit polyclonal antibody to DDX39 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 53 and 425 of DDX39 (Uniprot ID#O00148)

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492)

Rabbit Polyclonal Anti-UCHL5 Antibody - middle region

Applications WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Rabbit Polyclonal antibody to SEC13L1 (SEC13 homolog (S. cerevisiae))

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 319 of SEC13L1 (Uniprot ID#P55735)

Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7)

Rabbit Polyclonal antibody to SEC61A1 (Sec61 alpha 1 subunit (S. cerevisiae))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 413 and 476 of SEC61A1

Rabbit polyclonal YOD1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1.

Rabbit polyclonal anti-TBP antibody, Loading control

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP.

Rabbit polyclonal EN2 Antibody (C-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2.

Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557)

Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831)

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

Rabbit anti-STXBP1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Recombinant protein of human STXBP1

PACRG (204-215) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat, Zebrafish
Conjugation Unconjugated

Rabbit Polyclonal Antibody against TARDBP

Applications WB
Reactivities Human, Primate, Mouse, Xenopus, Zebrafish, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148]

Goat Polyclonal Antibody against SMO (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1.

Goat Polyclonal Antibody against VANGL2

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKYLRTTKQQPYH, from the internal region of the protein sequence according to NP_065068.1.

Rabbit polyclonal antibody to EML1 (echinoderm microtubule associated protein like 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 753 and 815 of EML1 (Uniprot ID#O00423)

Rabbit Polyclonal antibody to FBXO43 (F-box protein 43)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 646 and 708 of FBXO43 (Uniprot ID#Q4G163)

Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2)

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody

Applications IHC, WB
Reactivities Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein.

Rabbit polyclonal CAF-1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1.

Rabbit polyclonal METTL2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2.

Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb.

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal Anti-PTBP1 Antibody

Applications WB
Reactivities Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse
Conjugation Unconjugated
Immunogen The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

Goat Polyclonal Anti-MNSOD (aa119-130) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Zebrafish, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1.

USD 320.00

In Stock

Goat Polyclonal Anti-CDH11 Antibody

Applications WB
Reactivities Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide fused with GST and produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-CDH11 Antibody

Applications WB
Reactivities Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 752 aa to the C-terminus of CDH11 produced in E. coli.

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.

Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829)

Rabbit Polyclonal antibody to DLST (dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 188 and 453 of DLST (Uniprot ID#P36957)

Rabbit polyclonal antibody to RAB6A (RAB6A, member RAS oncogene family)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 208 of RAB6A (Uniprot ID#P20340)