Products

View as table Download

Rabbit anti-ALDH2 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Mouse monoclonal ALDH2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-HADHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADHA

Rabbit anti-ABAT Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABAT

Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1.

LDHA Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5G10

Applications ELISA, LMNX
Reactivities Human, Mouse
Conjugation Unconjugated
Matched ELISA Pair TA700008

ACAT1 mouse monoclonal antibody, clone AT15E5, Purified

Applications ELISA, WB
Reactivities Human

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Acetyl CoA synthetase (ACSS2) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Immunogen Purified S-Acetyl Coenzyme A Synthetase from baker's Yeast

Acetyl CoA synthetase (ACSS2) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Conjugation Biotin
Immunogen Purified S-Acetyl Coenzyme A Synthetase from baker's Yeast

Rabbit Polyclonal antibody to SUCLG1 (succinate-CoA ligase, alpha subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 346 of SUCLG1 (Uniprot ID#P53597)

Rabbit anti-ACADM Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM

Rabbit anti-PCCB Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PCCB

ACADM rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.

ALDH2 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit polyclonal Acetyl-CoA Carboxylase (Ser80) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human: Ser80, Mouse: Ser79, Rat: Ser79
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human acetyl-CoA carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L).
Modifications Phospho-specific

Rabbit polyclonal Acetyl-CoA Carboxylase (Ab-80) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Acetyl-CoA Carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L).

Rabbit polyclonal anti-EHHADH antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EHHADH.

Rabbit anti-LDHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LDHA

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

LDHA mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human

LDHA mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human

ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ACAT1.
Epitope: Internal.

LDHA (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 161~190 amino acids from the Central region of Human LDHA

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Goat Polyclonal Antibody against LDHC (aa 221 - 233)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DSDKEHWKNVHKQ, from the internal region of the protein sequence according to NP_002292.1; NP_059144.1.

Rabbit polyclonal antibody to MCD (malonyl-CoA decarboxylase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 90 and 304 of (Uniprot ID#O95822)

Rabbit Polyclonal antibody to SUCLG2 (succinate-CoA ligase, GDP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 234 of SUCLG2 (Uniprot ID#Q96I99)

Rabbit Polyclonal antibody to SUCLA2 (succinate-CoA ligase, ADP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 138 and 416 of SUCLA2 (Uniprot ID#Q9P2R7)

Rabbit polyclonal anti-ALDH1B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1.

Rabbit polyclonal HADHA Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA.

Rabbit Polyclonal ACC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ACC1

Rabbit Polyclonal ACC1 (Ser80) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ACC1 around the phosphorylation site of Serine 80
Modifications Phospho-specific

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)

Rabbit Polyclonal Anti-ACADM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338]