Germany
Japan
United Kingdom
China
USD 98.00
USD 800.00
In Stock
ATP1A1 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
MYL2 (Myc-DDK-tagged)-Human myosin, light chain 2, regulatory, cardiac, slow (MYL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CACNB2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 2 subunit (CACNB2), transcript variant 6
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ATP1B2 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ATP1A2 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 2 polypeptide (ATP1A2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SLC9A1 (Myc-DDK-tagged)-Human solute carrier family 9 (sodium/hydrogen exchanger), member 1 (SLC9A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
COX7A2L (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
TPM1 (Myc-DDK-tagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ATP1A3 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 3 polypeptide (ATP1A3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ATP2A2 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 (ATP2A2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ATP1A1 (untagged)-Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ATP2A2 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 (ATP2A2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ATP1A1 (GFP-tagged) - Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
COX7A2L (GFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNA1S (GFP-tagged) - Human calcium channel, voltage-dependent, L type, alpha 1S subunit (CACNA1S)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CACNB3 (untagged)-Human calcium channel, voltage-dependent, beta 3 subunit (CACNB3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC122090 is the updated version of SC119727.
ATP1A2 (untagged)-Human ATPase, Na+/K+ transporting, alpha 2 polypeptide (ATP1A2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 310.00
In Stock
ATP1B1 (untagged)-Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CACNA1D (untagged)-Human calcium channel, voltage-dependent, L type, alpha 1D subunit (CACNA1D), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Human ATPase, Na+/K+ transporting, alpha 3 polypeptide (ATP1A3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CACNG7 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 7 (CACNG7)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC122190 is the updated version of SC122107.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CACNB1 (untagged)-Human calcium channel, voltage-dependent, beta 1 subunit (CACNB1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TPM1 (untagged)-Human tropomyosin 1 (alpha) (TPM1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
COX4I2 (untagged)-Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
COX7A1 (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
COX8A (untagged)-Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-207 amino acids of Human tropomyosin 2 (beta) |
USD 399.00
In Stock
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
Active filters
Pathways
- Cardiac muscle contraction
Citations
- Yes