Products

View as table Download

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S).
Modifications Phospho-specific

Rabbit polyclonal anti-ATG4D antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D.

Rabbit Polyclonal ULK2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ULK2 antibody was raised against a 17 amino acid peptide near the center of human ULK2 .

Rabbit Polyclonal ATG3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG3 antibody was raised against an 18 amino acid synthetic peptide near the center of human ATG3.

Rabbit polyclonal ATG7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 494-523 amino acids from human ATG7.

Rabbit polyclonal ATG7 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 540-569 amino acids from the C-terminal region of human ATG7.

Rabbit polyclonal ULK2 Antibody (Center S323)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ULK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the Central region of human ULK2.

Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485
Modifications Phospho-specific

Rabbit Polyclonal ULK3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ULK3 antibody was raised against a 19 amino acid peptide near the center of human ULK3.

Rabbit Polyclonal AMPK1 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AMPK1

Rabbit Polyclonal AMPK alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AMPK alpha

Anti-Human IFN-? Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IFN-γ

Rabbit anti-IFNG Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNG

Rabbit Polyclonal Anti-GABARAPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the middle region of human GABARAPL1. Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI

Rabbit Polyclonal Anti-ATG5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Insulin (INS) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Bovine, Porcine, Rat
Conjugation Unconjugated

AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from Human AMPKα1 around the phosphorylation site of Serine 486.

Insulin (INS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AMPK alpha 1 (PRKAA1) pThr174 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum

Applications IF, IHC
Reactivities Hamster, Human, Porcine, Rat
Immunogen Synthetic Human proinsulin

Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly purified recombinant Inferferon gamma.

Rabbit Polyclonal Beclin-1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Beclin-1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human Beclin-1.

Rabbit Polyclonal APG7 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APG7 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human APG7.

Rabbit Polyclonal APG7 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APG7 antibody was raised against a 17 amino acid peptide from near the amino terminus of human APG7.

Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881)

Goat Anti-PRKAA2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2.

Rabbit polyclonal anti-ATG4A antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATG4A.

Rabbit Polyclonal GABARAP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GABARAP antibody was raised against a 19 amino acid peptide near the amino terminus of human GABARAP.

Rabbit Polyclonal Phospho-AMPK alpha (Thr172) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AMPK alpha around the phosphorylation site of Threonine 172
Modifications Phospho-specific

Rabbit Polyclonal Anti-GABARAPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the N terminal of human GABARAPL1. Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Rabbit Polyclonal GABARAP Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human GABARAP protein (within residues 50-117). [Swiss-Prot O95166]

Rabbit Polyclonal ATG4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 350-400 of human APG4B was used as the immunogen.

Rabbit Polyclonal ULK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN.

AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S).

AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S).

AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human AMPKα1 around the phosphorylation site of Serine 486.

AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human AMPKα1.

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

Insulin (INS) sheep polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen C-Peptide conjugate EAEDLQVGQVKKKC- KLH

GABARAPL2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GABARAPL2

GABARAP rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013)

Goat Polyclonal Antibody against ULK3 (aa445-458)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1.

Goat Polyclonal Anti-ATG4C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen C- terminus of NP_116241.2; NP_835739.1 (EDEKKQLKRFSTEE)

Rabbit polyclonal IFNA4 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4.

Rabbit polyclonal anti-ATG4B antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B.