Products

Primary Antibodies (174)
View as table Download

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612)

Mouse Monoclonal GSK-3 beta Antibody (3D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.

Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

Rabbit polyclonal anti-STK36 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STK36.

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.

GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta.

Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV

Rabbit Polyclonal Anti-KAPC A/B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KAPC A/B Antibody: A synthesized peptide derived from human KAPC A/B

Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CSNK1G2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CSNK1G1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GSK3 beta (GSK3B) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen GSK3B antibody was raised against synthetic peptide

Rabbit polyclonal anti-KAPCG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAPCG.

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Rabbit polyclonal anti-KAPC A/B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B.

Rabbit polyclonal anti-KAPCB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KAPCB.

Rabbit polyclonal anti-CKI-?1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CKI-?1.

Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B.
Modifications Phospho-specific

Rabbit Polyclonal GSK3 beta (Ser9) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GSK3 beta around the phosphorylation site of Serine 9
Modifications Phospho-specific

GSK3 beta (GSK3B) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen GSK3B antibody was raised against synthetic peptide derived from sequence near the carboxyterminus of human GSK3-beta

Rabbit polyclonal GSK3beta (Ab-9) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GSK3β

Rabbit polyclonal Casein Kinase I a (Ab-321) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Casein Kinase I a around the phosphorylation site of threonine 321 (A-Q-TP-P-T).

Rabbit polyclonal GSK3 Beta phospho S9 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta.

Rabbit Polyclonal GSK3 beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GSK3 beta

Rabbit Polyclonal Anti-PRKACB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the middle region of human PRKACB. Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI

PRKACA (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal(K282) region of human PRKACA

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.

Rabbit polyclonal GSK3beta (Ser9) antibody(Phospho-specific)

Applications WB
Reactivities Human: Ser9, Mouse: Ser9, Rat: Ser9
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GSK3β
Modifications Phospho-specific

Rabbit polyclonal GSK-3Beta Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the sequence near the C-terminus of human GSK-3Beta.

Rabbit Polyclonal Anti-PRKACB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL

Rabbit Polyclonal Anti-CSNK1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Rabbit Polyclonal Anti-CSNK1G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the N terminal of human CSNK1G2. Synthetic peptide located within the following region: FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK

Rabbit Polyclonal Anti-CSNK1G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Rabbit Polyclonal Anti-CSNK1G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Rabbit Polyclonal Anti-CSNK1A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1L antibody: synthetic peptide directed towards the middle region of human CSNK1A1L. Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD

Rabbit polyclonal Anti-PRKX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Rabbit anti Glycogen Synthase Kinase 3b (GSK3b) Polyclonal Antibody

Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated