Germany
Japan
United Kingdom
China
Products
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-MSH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Colorectal cancer
Filter by
Target Symbol
- TP53 (255)
- MAP2K1 (237)
- EGFR (207)
- JUN (183)
- CTNNB1 (162)
- AKT1 (127)
- BCL2 (105)
- BRAF (100)
- MLH1 (88)
- MAPK1 (74)
- FOS (64)
- MET (64)
- PIK3CG (64)
- PDGFRA (63)
- MYC (61)
- KRAS (58)
- MAPK8 (55)
- PDGFRB (50)
- CASP3 (49)
- PIK3R5 (47)
- AKT2 (44)
- BIRC5 (43)
- DVL2 (40)
- CCND1 (37)
- BAX (35)
- PIK3CD (35)
- SMAD2 (34)
- RAF1 (33)
- MAPK9 (31)
- IGF1R (29)
- CASP9 (26)
- PIK3CA (25)
- ARAF (24)
- SMAD3 (24)
- MAPK3 (23)
- TGFB1 (22)
- BAD (21)
- APC (20)
- GSK3B (20)
- TGFBR2 (20)
- AKT3 (19)
- MAPK10 (19)
- CYCS (17)
- MSH2 (16)
- APPL1 (15)
- DCC (15)
- MSH6 (15)
- PIK3R1 (14)
- GRB2 (11)
- LEF1 (11)
- SMAD4 (9)
- TCF7 (9)
- FZD2 (8)
- FZD4 (8)
- TGFB2 (8)
- TGFBR1 (8)
- FZD8 (6)
- FZD9 (6)
- RAC1 (6)
- ACVR1B (5)
- ACVR1C (5)
- AXIN1 (5)
- FZD1 (5)
- FZD10 (5)
- TGFB3 (5)
- AXIN2 (4)
- DVL1 (4)
- FZD3 (4)
- FZD5 (4)
- FZD6 (4)
- PIK3CB (4)
- PIK3R3 (4)
- TCF7L2 (4)
- APC2 (3)
- DVL3 (3)
- SOS2 (3)
- TCF7L1 (3)
- B RAF (2)
- CASPASE 9 (2)
- FZD7 (2)
- MSH3 (2)
- PIK3R2 (2)
- RAC2 (2)
- SOS1 (2)
- C FOS (1)
- RALGDS (1)
Reactivities
- Human (2708)
- Mouse (2277)
- Rat (2197)
- Monkey (496)
- Dog (414)
- Bovine (30)
- Chicken (22)
- Pig (20)
- Xenopus (12)
- Canine (11)
- Cow (11)
- Zebrafish (8)
- Drosophila (7)
- Primate (6)
- Rabbit (6)
- Feline (4)
- Hamster (4)
- Gerbil (3)
- X. tropicalis (3)
- C. elegans (2)
- Canis (2)
- Chimpanzee (2)
- Sheep (2)
- Yeast (2)
- Equine (1)
- Guinea Pig (1)
- Horse (1)
- Mammalian (1)
- Rhesus Monkey (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2990)
- ES Cell Differentiation/IPS (1338)
- Protein Kinase (1259)
- Transcription Factors (842)
- Transmembrane (671)
- Stem cell - Pluripotency (562)
- Stem cell relevant signaling - JAK/STAT signaling pathway (363)
- Cancer stem cells (265)
- Secreted Protein (242)
- Adult stem cells (218)
- Embryonic stem cells (119)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (119)
- Stem cell relevant signaling - Wnt Signaling pathway (103)
- Protease (77)
- Induced pluripotent stem cells (65)
- GPCR (44)
- Stem cell relevant signaling - DSL/Notch pathway (37)