Germany
Japan
United Kingdom
China
GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF clone of Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (Myc-DDK tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (mGFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GTF2A1 (mGFP-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (mGFP-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2A1 (myc-DDK-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-GTF2A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the middle region of human GTF2A1. Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG |
Rabbit Polyclonal Anti-GTF2A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1. Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM |
Rabbit Polyclonal anti-GTF2A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN |
GTF2A1 / TF2A1 (1-274, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
GTF2A1 / TF2A1 (1-274, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 (untagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GTF2A1 (untagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
SC310468 is the updated version of SC114600.
GTF2A1 (untagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of GTF2A1 (NM_201595) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2A1 (NM_015859) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2A1 (NM_001278940) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2A1 (NM_201595) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2A1 (NM_201595) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GTF2A1 (NM_015859) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GTF2A1 (NM_001278940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GTF2A1
Pathways
- Basal transcription factors