Germany
Japan
United Kingdom
China
CCL5 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 5 (CCL5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CCL5 (Myc-DDK tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CCL5 (mGFP-tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-C motif) ligand 5 (CCL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCL5 (Myc-DDK tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CCL5 (mGFP-tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CCL5 (myc-DDK-tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CCL5 (GFP-tagged) - Human chemokine (C-C motif) ligand 5 (CCL5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CCL5 (untagged)-Human chemokine (C-C motif) ligand 5 (CCL5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human chemokine (C-C motif) ligand 5 (CCL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5 / RANTES)
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of chemokine (C-C motif) ligand 5 (CCL5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human chemokine (C-C motif) ligand 5 (CCL5).
| Tag | Tag Free |
| Expression Host | E. coli |
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
CCL5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human chemokine (C-C motif) ligand 5 (CCL5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CCL5 (untagged) - Human chemokine (C-C motif) ligand 5 (CCL5), transcript variant 2
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ35131 fis, clone PLACE6008824
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Human cDNA FLJ37558 fis, clone BRCOC1000087
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Homo sapiens, clone MGC:10969 IMAGE:3634966, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Homo sapiens, clone MGC:16308 IMAGE:3836116, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
(untagged)-Homo sapiens, clone MGC:10782 IMAGE:3608303, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CCL5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
RANTES / CCL5 (24-91) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
RANTES / CCL5 (24-91) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002976)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CCL5 (GFP-tagged) - Human chemokine (C-C motif) ligand 5 (CCL5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
(untagged)-Human cDNA FLJ40780 fis, clone TRACH2005769, weakly similar to RAC-BETA SERINE/THREONINE KINASE (EC 2.7.1.-)
| Vector | pCMV6 series |
| Tag | Tag Free |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of CCL5 (NM_002985) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCL5 (NM_001278736) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 5 (CCL5)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of CCL5 (NM_002985) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- CCL5
Pathways
- Chemokine signaling pathway