Products

cDNA Clones (16)
Antibodies (14)
Proteins (14)
Jump to Filters
View as table Download
Vinculin (VCL) (NM_003373) Human Tagged ORF Clone
RC204576

USD 98.00

USD 800.00

In Stock

VCL (Myc-DDK-tagged)-Human vinculin (VCL), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Vinculin (VCL) (NM_003373) Human Tagged ORF Clone
RG204576

USD 1,060.00

In Stock

VCL (GFP-tagged) - Human vinculin (VCL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vinculin (VCL) Rabbit Polyclonal Antibody
TA349159

USD 484.00

2 Weeks

Rabbit Polyclonal Anti-MKRN3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MKRN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MKRN3.
Vinculin (VCL) (NM_014000) Human Tagged ORF Clone
RC219299

USD 1,190.00

2 Weeks

VCL (Myc-DDK-tagged)-Human vinculin (VCL), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Vinculin (VCL) (NM_003373) Human Tagged ORF Clone
RC204576L3

USD 1,160.00

3 Weeks

Lenti ORF clone of Human vinculin (VCL), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vinculin (VCL) (NM_003373) Human Tagged ORF Clone
RC204576L4

USD 1,160.00

3 Weeks

Lenti ORF clone of Human vinculin (VCL), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vinculin (VCL) (NM_014000) Human Tagged ORF Clone
RC219299L3

USD 1,390.00

3 Weeks

Lenti-ORF clone of VCL (Myc-DDK-tagged)-Human vinculin (VCL), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Vinculin (VCL) (NM_014000) Human Tagged ORF Clone
RC219299L4

USD 1,390.00

3 Weeks

Lenti-ORF clone of VCL (mGFP-tagged)-Human vinculin (VCL), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Vinculin (VCL) (NM_014000) Human Tagged ORF Clone
RG219299

USD 1,310.00

3 Weeks

VCL (GFP-tagged) - Human vinculin (VCL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Vinculin (VCL) (NM_003373) Human Untagged Clone
SC117985

USD 310.00

In Stock

VCL (untagged)-Human vinculin (VCL), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Vinculin (VCL) (NM_003373) Human Over-expression Lysate
LY418728

USD 396.00

In Stock

Transient overexpression lysate of vinculin (VCL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vinculin (VCL) Rabbit Polyclonal Antibody
TA326660

USD 430.00

5 Days

Rabbit Polyclonal Vinculin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin.
Vinculin (VCL) Rabbit Polyclonal Antibody
TA327166

USD 275.00

2 Weeks

Rabbit polyclonal anti-Vinculin antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VCL
Vinculin (VCL) Mouse Monoclonal Antibody [Clone ID: VIN-54]
AM20685PU-N

USD 405.00

2 Weeks

Vinculin (VCL) mouse monoclonal antibody, clone VIN-54, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Vinculin (VCL) Rabbit Polyclonal Antibody
TA347873

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-vinculin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-vinculin Antibody: A synthesized peptide derived from human vinculin
Vinculin (VCL) Rabbit Polyclonal Antibody
AP31334PU-N

USD 440.00

2 Weeks

Vinculin (VCL) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
Vinculin (VCL) Mouse Monoclonal Antibody [Clone ID: 7E10]
TA349007

USD 484.00

5 Days

Mouse Monoclonal Anti-Vinculin Antibody [7E10]

Applications WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Vinculin (VCL) (NM_003373) Human Over-expression Lysate
LC418728

USD 121.00

In Stock

VCL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Vinculin (VCL) Rabbit Polyclonal Antibody
TA325968

USD 345.00

In Stock

Rabbit Polyclonal Vinculin (Tyr821) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vinculin around the phosphorylation site of Tyrosine 821
Modifications Phospho-specific
Vinculin (VCL) Rabbit Polyclonal Antibody
TA327857

USD 345.00

In Stock

Rabbit Polyclonal Vinculin Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vinculin
Vinculin (VCL) Rabbit Polyclonal Antibody
TA355000

USD 430.00

5 Days

Rabbit Polyclonal Anti-Vinculin Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Vinculin antibody was raised against a 23 amino acid peptide near the amino of human Vinculin.
Vinculin (VCL) Rabbit Polyclonal Antibody
TA343106

USD 375.00

5 Days

Rabbit Polyclonal Anti-VCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA
Vinculin (VCL) Rabbit Polyclonal Antibody
TA355040

USD 430.00

5 Days

Rabbit Polyclonal Anti-Vinculin Antibody (biotin)

Applications WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin.
Vinculin (VCL) Mouse Monoclonal Antibody [Clone ID: 8B5]
TA355048

USD 430.00

5 Days

Mouse Monoclonal Anti-Vinculin Antibody [8B5]

Applications WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Vinculin (VCL) (NM_003373) Human Mass Spec Standard
PH304576

USD 2,055.00

3 Weeks

VCL MS Standard C13 and N15-labeled recombinant protein (NP_003364)

Tag C-Myc/DDK
Expression Host HEK293
Vinculin (VCL) (NM_014000) Human Untagged Clone
SC109880

USD 2,300.00

6 Weeks

VCL (untagged)-Human vinculin (VCL), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Vinculin (VCL) Rabbit Polyclonal Antibody
TA322857

USD 345.00

4 Weeks

Anti-VCL Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 811-824 amino acids of human vinculin
Vinculin (VCL) ICC Control Block
TB404576

USD 1,450.00

4 Weeks

Transient overexpression of VCL (NM_003373) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Vinculin (VCL) ICC Control Block
TB419299

USD 1,840.00

4 Weeks

Transient overexpression of VCL (NM_014000) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Vinculin (VCL) (NM_003373) Human Recombinant Protein
TP720619

USD 330.00

3 Weeks

Purified recombinant protein of Human vinculin (VCL), transcript variant 2

Tag tag free
Expression Host E. coli
Vinculin (VCL) (NM_003373) Human Recombinant Protein
TP720619L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human vinculin (VCL), transcript variant 2

Tag tag free
Expression Host E. coli
Vinculin (VCL) (NM_003373) Human Recombinant Protein
TP720619M

USD 760.00

3 Weeks

Purified recombinant protein of Human vinculin (VCL), transcript variant 2

Tag tag free
Expression Host E. coli
Vinculin (VCL) (NM_003373) Human Recombinant Protein
TP720619XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human vinculin (VCL), transcript variant 2

Tag tag free
Expression Host E. coli
Vinculin (VCL) Cytosection
TS404576

USD 225.00

4 Weeks

Transient overexpression of VCL (NM_003373) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Vinculin (VCL) Cytosection
TS404576P5

USD 889.00

4 Weeks

Transient overexpression of VCL (NM_003373) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Vinculin (VCL) Cytosection
TS419299

USD 225.00

4 Weeks

Transient overexpression of VCL (NM_014000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Vinculin (VCL) Cytosection
TS419299P5

USD 889.00

4 Weeks

Transient overexpression of VCL (NM_014000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack