Products

cDNA Clones (36)
Proteins (18)
Antibodies (9)
Jump to Filters
View as table Download
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone
RC228475

USD 480.00

In Stock

ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone
RC228502

USD 570.00

In Stock

ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone
RC229074

USD 1,390.00

In Stock

ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone
RC220699

USD 1,410.00

In Stock

ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone
RC220699L3

USD 1,610.00

3 Weeks

Lenti-ORF clone of ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone Lentiviral Particle
RC220699L3V

USD 1,810.00

6 Weeks

Lenti ORF particles, ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone
RC220699L4

USD 1,610.00

3 Weeks

Lenti-ORF clone of ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone Lentiviral Particle
RC220699L4V

USD 1,810.00

6 Weeks

Lenti ORF particles, ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone
RC228475L3

USD 680.00

3 Weeks

Lenti ORF clone of Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone Lentiviral Particle
RC228475L3V

USD 880.00

6 Weeks

Lenti ORF particles, ACIN1 (Myc-DDK tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone
RC228475L4

USD 680.00

3 Weeks

Lenti ORF clone of Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone Lentiviral Particle
RC228475L4V

USD 880.00

6 Weeks

Lenti ORF particles, ACIN1 (mGFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone
RC228502L3

USD 770.00

3 Weeks

Lenti-ORF clone of ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone Lentiviral Particle
RC228502L3V

USD 970.00

6 Weeks

Lenti ORF particles, ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone
RC228502L4

USD 770.00

3 Weeks

Lenti-ORF clone of ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone Lentiviral Particle
RC228502L4V

USD 970.00

6 Weeks

Lenti ORF particles, ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone
RC228670

USD 1,370.00

6 Weeks

ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone
RC228670L3

USD 1,570.00

6 Weeks

Lenti-ORF clone of ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone Lentiviral Particle
RC228670L3V

USD 1,770.00

9 Weeks

Lenti ORF particles, ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone
RC228670L4

USD 1,570.00

6 Weeks

Lenti-ORF clone of ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone Lentiviral Particle
RC228670L4V

USD 1,770.00

9 Weeks

Lenti ORF particles, ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone
RC229074L3

USD 1,590.00

3 Weeks

Lenti-ORF clone of ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone Lentiviral Particle
RC229074L3V

USD 1,790.00

6 Weeks

Lenti ORF particles, ACIN1 (Myc-DDK-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone
RC229074L4

USD 1,590.00

3 Weeks

Lenti-ORF clone of ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone Lentiviral Particle
RC229074L4V

USD 1,790.00

6 Weeks

Lenti ORF particles, ACIN1 (mGFP-tagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Acinus (ACIN1) (NM_014977) Human Tagged ORF Clone
RG220699

USD 1,550.00

3 Weeks

ACIN1 (GFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_001164817) Human Tagged ORF Clone
RG228475

USD 530.00

3 Weeks

ACIN1 (GFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_001164816) Human Tagged ORF Clone
RG228502

USD 630.00

3 Weeks

ACIN1 (GFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_001164815) Human Tagged ORF Clone
RG228670

USD 1,510.00

7 Weeks

ACIN1 (GFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) (NM_001164814) Human Tagged ORF Clone
RG229074

USD 1,530.00

3 Weeks

ACIN1 (GFP-tagged) - Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA344399

USD 475.00

5 Days

Rabbit Polyclonal Anti-Acin1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Acin1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acin1. Synthetic peptide located within the following region: RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA306020

USD 430.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a 35 amino acid peptide near the center of human Acinus. The immunogen is located within amino acids 760 - 810 of Acinus.
Acinus (ACIN1) (NM_001164816) Human Over-expression Lysate
LC431530

USD 121.00

In Stock

ACIN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA306018

USD 430.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids near the C-terminus of the cleaved active peptide p17, which are identical to those of mouse Acinus. The immunogen is located within amino acids 1050 - 1100 of Acinus.
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA306019

USD 430.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids near the carbosy terminus of human AcinusL, which are identical to those of mouse Acinus.
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA336657

USD 350.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A peptide made to the C-terminal sequence RNRQLEREKRREHS.
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA306029

USD 430.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids 994 to 1009 of human AcinusL, 267 to 282 of human AcinusS’, or 236 to 251 of human AcinusS, which are identical to those of mouse Acinus. The selected antigenic sequence is located near the N-terminus of active peptide p17.
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA336656

USD 350.00

5 Days

Rabbit Polyclonal Acinus Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen C-terminus of Acinus (proprietary peptide).
Acinus (ACIN1) (NM_001164817) Human Over-expression Lysate
LC431503

USD 121.00

2 Weeks

ACIN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Acinus (ACIN1) (NM_014977) Human Untagged Clone
SC304192

USD 2,720.00

3 Weeks

ACIN1 (untagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Acinus (ACIN1) (AF124728) Human Untagged Clone
SC314203

USD 1,750.00

5 Weeks

(untagged)-Human acinusS' mRNA, complete cds

Vector pCMV6 series
Tag Tag Free
Acinus (ACIN1) (NM_001164817) Human Untagged Clone
SC327110

USD 1,000.00

3 Weeks

ACIN1 (untagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1) transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Acinus (ACIN1) (NM_001164816) Human Untagged Clone
SC327137

USD 1,040.00

3 Weeks

ACIN1 (untagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1) transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Acinus (ACIN1) (NM_001164815) Human Untagged Clone
SC327305

USD 2,640.00

7 Weeks

ACIN1 (untagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Acinus (ACIN1) (NM_001164814) Human Untagged Clone
SC327709

USD 1,100.00

7 Weeks

ACIN1 (untagged)-Human apoptotic chromatin condensation inducer 1 (ACIN1) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324009

USD 345.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) Rabbit Polyclonal Antibody
TA324010

USD 345.00

In Stock

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1
Acinus (ACIN1) (NM_014977) ICC Control Block
TB420699

USD 2,060.00

4 Weeks

Transient overexpression of ACIN1 (NM_014977) in HEK293T cells paraffin embedded controls for ICC/IHC staining