U exon (AC_000006) Virus Tagged ORF Clone
CAT#: VC100419
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus D], codon optimized for human cell expression, AP_000156
View other clones from "Virus" (17)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | U exon |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100419 represents NCBI reference of AP_000156 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAATAGTAGATCAGGAGTTCGATATACCGTTTAAAGTCTGGAGGAAATTTGCGGCAAGACGCCGCC TGGAATATCAGTCCTGGGAGGAGGGAACAGAGGTATTGTTGAACAACTACACCCGAGATATTCTGTCTGA TTTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100419 representing AP_000156
Red=Cloning sites Green=Tags MKIVDQEFDIPFKVWRKFAARRRLEYQSWEEGTEVLLNNYTRDILSDF TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | AC_000006 |
ORF Size | 144 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | AC_000006.1, AP_000156 |
RefSeq ORF | 144 |
MW | 6.0 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100405 | Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus D], codon optimized for human cell expression, AP_000142 |
USD 400.00 |
|
VC100407 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus D], codon optimized for human cell expression, AP_000144 |
USD 800.00 |
|
VC100408 | Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus D], codon optimized for human cell expression, AP_000145 |
USD 470.00 |
|
VC100409 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus D], codon optimized for human cell expression, AP_000146 |
USD 720.00 |
|
VC100410 | Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus D], codon optimized for human cell expression, AP_000147 |
USD 660.00 |
|
VC100411 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus D], codon optimized for human cell expression, AP_000148 |
USD 400.00 |
|
VC100412 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus D], codon optimized for human cell expression, AP_000149 |
USD 400.00 |
|
VC100413 | Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus D], codon optimized for human cell expression, AP_000150 |
USD 400.00 |
|
VC100414 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha1 [Human adenovirus D], codon optimized for human cell expression, AP_000151 |
USD 400.00 |
|
VC100415 | Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus D], codon optimized for human cell expression, AP_000152 |
USD 400.00 |
|
VC100416 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-gamma1 [Human adenovirus D], codon optimized for human cell expression, AP_000153 |
USD 400.00 |
|
VC100417 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus D], codon optimized for human cell expression, AP_000154 |
USD 400.00 |
|
VC100418 | Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus D], codon optimized for human cell expression, AP_000155 |
USD 400.00 |
|
VC100420 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus D], codon optimized for human cell expression, AP_000157 |
USD 460.00 |
|
VC100421 | Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus D], codon optimized for human cell expression, AP_000158 |
USD 400.00 |
|
VC100422 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus D], codon optimized for human cell expression, AP_000159 |
USD 400.00 |
|
VC100423 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus D], codon optimized for human cell expression, AP_000160 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review